Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JFK6

Protein Details
Accession A0A197JFK6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
13-49YSPCSFGVEQRKEKKREKKRAKKKQRSEKTTTAKKVSHydrophilic
NLS Segment(s)
PositionSequence
23-41RKEKKREKKRAKKKQRSEK
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDRRILVSRVFFYSPCSFGVEQRKEKKREKKRAKKKQRSEKTTTAKKVSTYYSLSFHLSQPASQPTNQPTSETSHALPERKMLLIVQTPFFLSGGKFFLTLFFTLTPPEPCPRVFPCCQIRECSFYGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.28
4 0.25
5 0.29
6 0.4
7 0.43
8 0.48
9 0.57
10 0.65
11 0.68
12 0.77
13 0.82
14 0.82
15 0.85
16 0.87
17 0.88
18 0.91
19 0.94
20 0.96
21 0.96
22 0.96
23 0.96
24 0.96
25 0.93
26 0.9
27 0.89
28 0.88
29 0.86
30 0.82
31 0.75
32 0.66
33 0.58
34 0.53
35 0.45
36 0.39
37 0.32
38 0.28
39 0.25
40 0.25
41 0.26
42 0.24
43 0.22
44 0.22
45 0.19
46 0.17
47 0.17
48 0.2
49 0.19
50 0.18
51 0.2
52 0.18
53 0.23
54 0.23
55 0.21
56 0.18
57 0.22
58 0.24
59 0.23
60 0.21
61 0.22
62 0.24
63 0.25
64 0.24
65 0.21
66 0.2
67 0.18
68 0.18
69 0.12
70 0.13
71 0.16
72 0.18
73 0.16
74 0.15
75 0.15
76 0.15
77 0.15
78 0.12
79 0.08
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.11
86 0.12
87 0.12
88 0.13
89 0.12
90 0.12
91 0.13
92 0.16
93 0.17
94 0.18
95 0.21
96 0.22
97 0.21
98 0.27
99 0.3
100 0.35
101 0.36
102 0.42
103 0.47
104 0.52
105 0.55
106 0.56
107 0.55
108 0.53