Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JVM1

Protein Details
Accession I2JVM1   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-103EFLIRGRDSKKKKYKHKGLYELSKRYRHBasic
NLS Segment(s)
PositionSequence
84-95RDSKKKKYKHKG
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MLSEVPKMVKTINNTAVRRKFISQFLNVYENKKLLDEDTETTTXIKIPEDIRHKVIPALLGFMILQIDSEKFSEFVXEFLIRGRDSKKKKYKHKGLYELSKRYRXHX
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.59
4 0.59
5 0.57
6 0.53
7 0.48
8 0.47
9 0.49
10 0.44
11 0.41
12 0.4
13 0.43
14 0.4
15 0.39
16 0.34
17 0.29
18 0.25
19 0.23
20 0.2
21 0.14
22 0.15
23 0.15
24 0.15
25 0.17
26 0.19
27 0.18
28 0.18
29 0.19
30 0.16
31 0.14
32 0.14
33 0.12
34 0.15
35 0.21
36 0.23
37 0.25
38 0.25
39 0.26
40 0.24
41 0.23
42 0.2
43 0.14
44 0.13
45 0.1
46 0.09
47 0.09
48 0.08
49 0.07
50 0.05
51 0.05
52 0.04
53 0.04
54 0.05
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.07
61 0.08
62 0.1
63 0.1
64 0.09
65 0.14
66 0.14
67 0.15
68 0.19
69 0.27
70 0.32
71 0.43
72 0.53
73 0.58
74 0.69
75 0.79
76 0.87
77 0.88
78 0.91
79 0.91
80 0.91
81 0.92
82 0.91
83 0.9