Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JHQ7

Protein Details
Accession A0A197JHQ7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-84APALEKKETHRERNEKRNKALKNAQHydrophilic
NLS Segment(s)
PositionSequence
75-76KR
Subcellular Location(s) mito 10, nucl 7.5, cyto_nucl 7, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029060  PIN-like_dom_sf  
Amino Acid Sequences MHHHLPDDSIIRVDVLSFFTKIRYIYTKHANDKTMAQAILFEHLRKYGNPSRMVFYVDGAPALEKKETHRERNEKRNKALKNAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.12
5 0.12
6 0.12
7 0.14
8 0.14
9 0.17
10 0.18
11 0.2
12 0.25
13 0.35
14 0.41
15 0.47
16 0.51
17 0.49
18 0.46
19 0.44
20 0.41
21 0.35
22 0.27
23 0.19
24 0.16
25 0.15
26 0.17
27 0.15
28 0.12
29 0.09
30 0.1
31 0.11
32 0.1
33 0.18
34 0.21
35 0.26
36 0.31
37 0.32
38 0.34
39 0.34
40 0.37
41 0.29
42 0.24
43 0.21
44 0.16
45 0.15
46 0.11
47 0.11
48 0.1
49 0.11
50 0.11
51 0.1
52 0.14
53 0.25
54 0.32
55 0.4
56 0.5
57 0.59
58 0.67
59 0.78
60 0.85
61 0.83
62 0.86
63 0.86
64 0.81