Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197KAH0

Protein Details
Accession A0A197KAH0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MQQKARKKIREEGKVKRSSNHydrophilic
NLS Segment(s)
PositionSequence
6-11RKKIRE
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MQQKARKKIREEGKVKRSSNCFILYRTHIHPVIVARYGHQNNKEISRLAGRYWKNAPESVKSFYRQQAAEEKVRHAALYPSYKYTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.75
4 0.7
5 0.64
6 0.59
7 0.54
8 0.46
9 0.38
10 0.41
11 0.37
12 0.37
13 0.35
14 0.36
15 0.3
16 0.28
17 0.28
18 0.25
19 0.24
20 0.22
21 0.19
22 0.15
23 0.22
24 0.25
25 0.27
26 0.27
27 0.28
28 0.27
29 0.29
30 0.3
31 0.22
32 0.21
33 0.21
34 0.2
35 0.17
36 0.24
37 0.22
38 0.25
39 0.27
40 0.3
41 0.29
42 0.31
43 0.33
44 0.31
45 0.34
46 0.34
47 0.35
48 0.34
49 0.36
50 0.36
51 0.39
52 0.33
53 0.33
54 0.37
55 0.39
56 0.44
57 0.42
58 0.4
59 0.39
60 0.39
61 0.35
62 0.28
63 0.27
64 0.27
65 0.32
66 0.33