Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JZ25

Protein Details
Accession A0A197JZ25    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-62TLNFLRKLFKVQPRKLQKPRVSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.333, nucl 10, cyto 8.5, mito 6, cyto_pero 5.666
Family & Domain DBs
Amino Acid Sequences MPCRTLYGVRKEKFDQQEVCNTISYQQDVYDRMEDIWVNLTLNFLRKLFKVQPRKLQKPRVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.54
3 0.48
4 0.54
5 0.51
6 0.49
7 0.41
8 0.34
9 0.29
10 0.25
11 0.23
12 0.14
13 0.13
14 0.13
15 0.14
16 0.16
17 0.14
18 0.13
19 0.12
20 0.12
21 0.11
22 0.1
23 0.1
24 0.09
25 0.08
26 0.08
27 0.09
28 0.09
29 0.12
30 0.13
31 0.11
32 0.13
33 0.13
34 0.2
35 0.28
36 0.37
37 0.46
38 0.52
39 0.62
40 0.71
41 0.81
42 0.85