Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DNV0

Protein Details
Accession J9DNV0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
117-140NKQNISQKKTKDLNKKITRKVFFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0016787  F:hydrolase activity  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00270  DEAD  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
Amino Acid Sequences MVELEEKTLEILKLNGITELLPVQKLTIPKFRESKDVMVQSPTGTGKTLSFVIPIIEFINKNQQNINKNKVQALIISPTRELALQIESTVKMFGIEALCMFGQNKSNEVDRKYETVNKQNISQKKTKDLNKKITRKVFFLIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.12
5 0.11
6 0.13
7 0.12
8 0.1
9 0.1
10 0.11
11 0.13
12 0.17
13 0.2
14 0.26
15 0.28
16 0.34
17 0.4
18 0.41
19 0.45
20 0.46
21 0.47
22 0.47
23 0.48
24 0.43
25 0.39
26 0.38
27 0.3
28 0.29
29 0.24
30 0.17
31 0.13
32 0.12
33 0.1
34 0.11
35 0.12
36 0.1
37 0.09
38 0.09
39 0.09
40 0.08
41 0.09
42 0.08
43 0.08
44 0.08
45 0.09
46 0.19
47 0.19
48 0.2
49 0.22
50 0.26
51 0.32
52 0.37
53 0.42
54 0.36
55 0.36
56 0.36
57 0.35
58 0.3
59 0.23
60 0.2
61 0.19
62 0.16
63 0.16
64 0.15
65 0.14
66 0.13
67 0.12
68 0.11
69 0.08
70 0.08
71 0.07
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.06
79 0.05
80 0.07
81 0.06
82 0.06
83 0.06
84 0.08
85 0.08
86 0.08
87 0.08
88 0.08
89 0.13
90 0.14
91 0.15
92 0.16
93 0.22
94 0.26
95 0.28
96 0.31
97 0.28
98 0.31
99 0.33
100 0.39
101 0.41
102 0.46
103 0.51
104 0.48
105 0.52
106 0.57
107 0.61
108 0.6
109 0.6
110 0.56
111 0.59
112 0.65
113 0.68
114 0.71
115 0.73
116 0.78
117 0.81
118 0.86
119 0.87
120 0.88
121 0.83
122 0.76