Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DFJ8

Protein Details
Accession J9DFJ8   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-35NPPLQWKLKPLKFPKKDLRNYGGKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004854  Ufd1-like  
IPR042299  Ufd1-like_Nn  
Gene Ontology GO:0050896  P:response to stimulus  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF03152  UFD1  
Amino Acid Sequences MFFNFFRRNANPPLQWKLKPLKFPKKDLRNYGGKCILPQIILAELFEMEIPTPYTFEISHCGGVFKTNCGVLDFTAEDLTITVPEWMYQQLDLAGTDKITLKIVVLPKGRYVKLLPHSHEFLDIENPKRELEKTLRNYQVLTQGDEILCNFEEGNMRFTVAEVKPAGLGVYIVDTDLEVEFLPPFGYEEKLEREKTVTKYLNVLKSDLHPRRISMKKPGLFFDFKKFSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.62
4 0.65
5 0.63
6 0.65
7 0.69
8 0.72
9 0.72
10 0.8
11 0.82
12 0.83
13 0.85
14 0.84
15 0.81
16 0.8
17 0.76
18 0.75
19 0.71
20 0.61
21 0.53
22 0.48
23 0.42
24 0.32
25 0.29
26 0.21
27 0.16
28 0.15
29 0.14
30 0.1
31 0.09
32 0.08
33 0.08
34 0.07
35 0.05
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.09
42 0.09
43 0.1
44 0.13
45 0.13
46 0.15
47 0.15
48 0.15
49 0.14
50 0.19
51 0.18
52 0.16
53 0.16
54 0.15
55 0.15
56 0.16
57 0.16
58 0.11
59 0.13
60 0.12
61 0.11
62 0.1
63 0.09
64 0.08
65 0.08
66 0.08
67 0.05
68 0.05
69 0.05
70 0.04
71 0.05
72 0.06
73 0.06
74 0.07
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.07
84 0.07
85 0.07
86 0.08
87 0.07
88 0.06
89 0.1
90 0.13
91 0.17
92 0.19
93 0.19
94 0.23
95 0.27
96 0.27
97 0.25
98 0.24
99 0.24
100 0.3
101 0.35
102 0.33
103 0.32
104 0.34
105 0.32
106 0.33
107 0.27
108 0.19
109 0.2
110 0.21
111 0.21
112 0.21
113 0.22
114 0.21
115 0.21
116 0.21
117 0.19
118 0.22
119 0.29
120 0.33
121 0.4
122 0.44
123 0.43
124 0.43
125 0.4
126 0.43
127 0.34
128 0.3
129 0.23
130 0.21
131 0.2
132 0.2
133 0.18
134 0.12
135 0.11
136 0.09
137 0.08
138 0.07
139 0.12
140 0.12
141 0.15
142 0.13
143 0.13
144 0.13
145 0.13
146 0.19
147 0.15
148 0.18
149 0.16
150 0.16
151 0.15
152 0.16
153 0.15
154 0.08
155 0.08
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.04
162 0.05
163 0.05
164 0.06
165 0.04
166 0.05
167 0.05
168 0.06
169 0.06
170 0.05
171 0.07
172 0.07
173 0.09
174 0.1
175 0.13
176 0.2
177 0.26
178 0.27
179 0.27
180 0.3
181 0.35
182 0.38
183 0.44
184 0.42
185 0.37
186 0.44
187 0.5
188 0.53
189 0.48
190 0.45
191 0.37
192 0.39
193 0.49
194 0.47
195 0.47
196 0.42
197 0.43
198 0.52
199 0.57
200 0.57
201 0.57
202 0.61
203 0.59
204 0.61
205 0.63
206 0.6
207 0.6
208 0.57
209 0.56