Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JMI1

Protein Details
Accession A0A197JMI1   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VSRHISVKRGRAKVRRKSKRQLQQCFTVLHydrophilic
69-98GKGQIMNKGKEKKNKQKRRDDEQWFRGKQRBasic
NLS Segment(s)
PositionSequence
9-21KRGRAKVRRKSKR
76-88KGKEKKNKQKRRD
Subcellular Location(s) mito 15.5, mito_nucl 10.833, cyto 6.5, cyto_nucl 6.333, nucl 5
Family & Domain DBs
Amino Acid Sequences MVSRHISVKRGRAKVRRKSKRQLQQCFTVLFNLQLRLGGSVECMCVVEVGKCGAWCQSLAALQTDWWDGKGQIMNKGKEKKNKQKRRDDEQWFRGKQRNGNQPTKPPPGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.87
4 0.87
5 0.89
6 0.9
7 0.91
8 0.91
9 0.91
10 0.85
11 0.83
12 0.77
13 0.68
14 0.58
15 0.5
16 0.39
17 0.32
18 0.28
19 0.2
20 0.16
21 0.15
22 0.15
23 0.13
24 0.13
25 0.09
26 0.09
27 0.08
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.07
46 0.08
47 0.09
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.08
54 0.08
55 0.07
56 0.1
57 0.13
58 0.14
59 0.21
60 0.28
61 0.31
62 0.38
63 0.47
64 0.5
65 0.57
66 0.66
67 0.69
68 0.74
69 0.81
70 0.84
71 0.87
72 0.9
73 0.9
74 0.9
75 0.89
76 0.89
77 0.88
78 0.88
79 0.81
80 0.77
81 0.75
82 0.71
83 0.68
84 0.67
85 0.68
86 0.67
87 0.72
88 0.73
89 0.75
90 0.78