Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197K6J4

Protein Details
Accession A0A197K6J4    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
115-137PVDPSVPKRGRGRPRKNPLPTDAHydrophilic
NLS Segment(s)
PositionSequence
66-74KRGRGRPRK
99-131PRKRGRPPKLNKVIKPPVDPSVPKRGRGRPRKN
173-182PRKRGRPRKE
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MSTIHRNPHSSSGQSYASYTHRSTAASAIPTAVNAVSTAVHSANAIVSSNSTATTTTPAAAAAPEKRGRGRPRKTPVETNNDGEDDSSSASENAPEVAPRKRGRPPKLNKVIKPPVDPSVPKRGRGRPRKNPLPTDASVTGVSGSGSTSSSTNVSTTSGSKGSGHHTSTIEPPRKRGRPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.29
4 0.28
5 0.29
6 0.27
7 0.24
8 0.23
9 0.23
10 0.24
11 0.23
12 0.24
13 0.2
14 0.2
15 0.19
16 0.17
17 0.16
18 0.16
19 0.12
20 0.08
21 0.07
22 0.07
23 0.06
24 0.06
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.06
34 0.06
35 0.07
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.1
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.11
49 0.09
50 0.14
51 0.16
52 0.18
53 0.2
54 0.28
55 0.37
56 0.45
57 0.5
58 0.55
59 0.62
60 0.7
61 0.72
62 0.74
63 0.72
64 0.71
65 0.67
66 0.6
67 0.52
68 0.43
69 0.38
70 0.28
71 0.22
72 0.13
73 0.1
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.08
84 0.1
85 0.17
86 0.18
87 0.23
88 0.29
89 0.39
90 0.46
91 0.54
92 0.61
93 0.65
94 0.75
95 0.79
96 0.75
97 0.76
98 0.77
99 0.71
100 0.66
101 0.57
102 0.5
103 0.47
104 0.45
105 0.4
106 0.42
107 0.41
108 0.42
109 0.46
110 0.51
111 0.57
112 0.66
113 0.72
114 0.72
115 0.8
116 0.85
117 0.87
118 0.83
119 0.79
120 0.75
121 0.65
122 0.61
123 0.51
124 0.43
125 0.35
126 0.29
127 0.24
128 0.16
129 0.15
130 0.08
131 0.07
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.09
138 0.1
139 0.1
140 0.1
141 0.11
142 0.12
143 0.13
144 0.15
145 0.15
146 0.16
147 0.17
148 0.18
149 0.22
150 0.27
151 0.27
152 0.28
153 0.28
154 0.3
155 0.37
156 0.45
157 0.49
158 0.45
159 0.51
160 0.58
161 0.66
162 0.74