Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JEM6

Protein Details
Accession A0A197JEM6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTRVFQKNRKRKPRLLFICLLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 7, cyto 1, plas 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTRVFQKNRKRKPRLLFICLLLGGTATAQSRAELGLVVTGGTLLLLTVVTAAVVLAVTALAVSTLGTLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.77
4 0.68
5 0.61
6 0.51
7 0.42
8 0.3
9 0.21
10 0.13
11 0.09
12 0.08
13 0.05
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02