Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197KD98

Protein Details
Accession A0A197KD98    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-47MPRRKITSKRIPANHRYKIEKRVKDHHRKLRKDSKSNPNVHHKNKKDBasic
NLS Segment(s)
PositionSequence
3-46RRKITSKRIPANHRYKIEKRVKDHHRKLRKDSKSNPNVHHKNKK
74-100AKDKAKEARRKAAEKARKANKARNTNP
105-120AAPTPAAEKKDKKRKA
151-169AAATKKTKTAAVTKKAGKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MPRRKITSKRIPANHRYKIEKRVKDHHRKLRKDSKSNPNVHHKNKKDPGIPNNFPFKEQILQQIADQKMKEQEAKDKAKEARRKAAEKARKANKARNTNPTEAEAAPTPAAEKKDKKRKAAAVEEDDEEAPTLVLSKAAQRKAEKASTAPAAATKKTKTAAVTKKAGKKQKEENDVEDAPYNFAEHFAGAEQDGDEEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.82
4 0.78
5 0.79
6 0.8
7 0.78
8 0.75
9 0.76
10 0.8
11 0.82
12 0.86
13 0.86
14 0.87
15 0.86
16 0.89
17 0.9
18 0.89
19 0.88
20 0.87
21 0.88
22 0.87
23 0.87
24 0.84
25 0.85
26 0.84
27 0.84
28 0.84
29 0.79
30 0.79
31 0.79
32 0.79
33 0.76
34 0.74
35 0.73
36 0.73
37 0.72
38 0.67
39 0.68
40 0.61
41 0.54
42 0.48
43 0.41
44 0.33
45 0.29
46 0.31
47 0.25
48 0.25
49 0.25
50 0.31
51 0.3
52 0.3
53 0.29
54 0.23
55 0.24
56 0.25
57 0.27
58 0.21
59 0.28
60 0.34
61 0.4
62 0.39
63 0.42
64 0.46
65 0.51
66 0.57
67 0.54
68 0.55
69 0.55
70 0.58
71 0.58
72 0.62
73 0.62
74 0.62
75 0.67
76 0.66
77 0.68
78 0.69
79 0.7
80 0.68
81 0.7
82 0.67
83 0.68
84 0.65
85 0.59
86 0.56
87 0.5
88 0.44
89 0.33
90 0.3
91 0.2
92 0.15
93 0.12
94 0.11
95 0.1
96 0.09
97 0.12
98 0.15
99 0.21
100 0.3
101 0.41
102 0.47
103 0.52
104 0.57
105 0.61
106 0.65
107 0.67
108 0.65
109 0.59
110 0.56
111 0.51
112 0.45
113 0.39
114 0.31
115 0.22
116 0.14
117 0.08
118 0.06
119 0.06
120 0.04
121 0.05
122 0.05
123 0.11
124 0.17
125 0.2
126 0.26
127 0.27
128 0.31
129 0.36
130 0.4
131 0.36
132 0.31
133 0.32
134 0.3
135 0.29
136 0.24
137 0.23
138 0.22
139 0.23
140 0.26
141 0.23
142 0.24
143 0.25
144 0.27
145 0.26
146 0.34
147 0.41
148 0.44
149 0.51
150 0.55
151 0.63
152 0.69
153 0.74
154 0.71
155 0.69
156 0.73
157 0.74
158 0.77
159 0.72
160 0.68
161 0.67
162 0.62
163 0.56
164 0.49
165 0.4
166 0.31
167 0.27
168 0.23
169 0.15
170 0.15
171 0.13
172 0.09
173 0.09
174 0.08
175 0.09
176 0.09
177 0.09
178 0.08
179 0.08
180 0.09
181 0.09