Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K3H9

Protein Details
Accession A0A197K3H9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-44KVKSQTPKVAKQEKKKKLTGRAKKRDTYKRRFBasic
NLS Segment(s)
PositionSequence
11-43AGKVKSQTPKVAKQEKKKKLTGRAKKRDTYKRR
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVAKQEKKKKLTGRAKKRDTYKRRFVNVTNAPGGKRRMNVNPESTKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.45
4 0.48
5 0.52
6 0.6
7 0.64
8 0.69
9 0.71
10 0.74
11 0.78
12 0.79
13 0.8
14 0.79
15 0.77
16 0.77
17 0.8
18 0.8
19 0.8
20 0.81
21 0.81
22 0.79
23 0.82
24 0.82
25 0.81
26 0.8
27 0.79
28 0.77
29 0.75
30 0.74
31 0.67
32 0.67
33 0.64
34 0.6
35 0.55
36 0.48
37 0.44
38 0.44
39 0.46
40 0.39
41 0.35
42 0.36
43 0.39
44 0.45
45 0.5
46 0.54