Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DKT6

Protein Details
Accession J9DKT6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
172-193MVELKKHKLYHLRKKYIQHLIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036224  GINS_bundle-like_dom_sf  
IPR005339  GINS_Psf1  
Gene Ontology GO:0000811  C:GINS complex  
GO:0006260  P:DNA replication  
Amino Acid Sequences MSLGEAGKKLLNDLKSSDILPYNFNTVNALQIENELLRREMEDLKLHAEGNEITTELSINYIVLRNLILRNERIFHGYLFHRYVNIGNSILNNECKYLNSHQSNHKKEAKNNFLRNLCDDEKTYLNIYQNAYKKYKSEFWFIDFDTTEPPLELFICIFTNEDCGVIMCGNDMVELKKHKLYHLRKKYIQHLIESRKIKIIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.28
5 0.28
6 0.26
7 0.26
8 0.25
9 0.25
10 0.24
11 0.24
12 0.24
13 0.19
14 0.22
15 0.2
16 0.19
17 0.14
18 0.14
19 0.15
20 0.13
21 0.15
22 0.12
23 0.12
24 0.11
25 0.12
26 0.14
27 0.15
28 0.17
29 0.19
30 0.19
31 0.21
32 0.22
33 0.22
34 0.19
35 0.18
36 0.15
37 0.13
38 0.12
39 0.1
40 0.08
41 0.08
42 0.08
43 0.06
44 0.07
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.07
52 0.08
53 0.1
54 0.12
55 0.14
56 0.14
57 0.16
58 0.18
59 0.18
60 0.19
61 0.18
62 0.16
63 0.17
64 0.17
65 0.2
66 0.2
67 0.2
68 0.17
69 0.17
70 0.18
71 0.16
72 0.16
73 0.12
74 0.1
75 0.1
76 0.12
77 0.12
78 0.12
79 0.11
80 0.1
81 0.1
82 0.1
83 0.13
84 0.15
85 0.22
86 0.25
87 0.28
88 0.36
89 0.46
90 0.5
91 0.53
92 0.59
93 0.54
94 0.57
95 0.63
96 0.64
97 0.64
98 0.64
99 0.64
100 0.59
101 0.56
102 0.53
103 0.49
104 0.4
105 0.33
106 0.29
107 0.25
108 0.23
109 0.23
110 0.22
111 0.18
112 0.19
113 0.2
114 0.2
115 0.24
116 0.28
117 0.31
118 0.32
119 0.3
120 0.31
121 0.32
122 0.39
123 0.35
124 0.37
125 0.35
126 0.36
127 0.39
128 0.37
129 0.36
130 0.28
131 0.26
132 0.21
133 0.2
134 0.16
135 0.13
136 0.12
137 0.09
138 0.09
139 0.09
140 0.07
141 0.07
142 0.08
143 0.08
144 0.09
145 0.08
146 0.11
147 0.1
148 0.1
149 0.09
150 0.09
151 0.1
152 0.09
153 0.09
154 0.06
155 0.07
156 0.06
157 0.07
158 0.07
159 0.08
160 0.13
161 0.17
162 0.2
163 0.25
164 0.26
165 0.32
166 0.42
167 0.51
168 0.57
169 0.65
170 0.71
171 0.73
172 0.8
173 0.84
174 0.84
175 0.76
176 0.74
177 0.72
178 0.71
179 0.73
180 0.69
181 0.62