Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JZ76

Protein Details
Accession A0A197JZ76    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-72DVNRKKHFENAKEKRKKLEKABasic
NLS Segment(s)
PositionSequence
56-69KKHFENAKEKRKKL
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, cyto 8, cyto_pero 5.333, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSKLDLHKHVSCEDIILQLDQCHNEGILHRYLGGCNKLKNAMNECLQAEFDVNRKKHFENAKEKRKKLEKAWEGMDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.17
4 0.15
5 0.14
6 0.14
7 0.15
8 0.13
9 0.13
10 0.11
11 0.1
12 0.1
13 0.11
14 0.13
15 0.13
16 0.12
17 0.12
18 0.12
19 0.13
20 0.15
21 0.18
22 0.17
23 0.17
24 0.18
25 0.22
26 0.24
27 0.26
28 0.28
29 0.27
30 0.26
31 0.27
32 0.27
33 0.23
34 0.21
35 0.18
36 0.14
37 0.12
38 0.16
39 0.22
40 0.22
41 0.24
42 0.28
43 0.29
44 0.35
45 0.43
46 0.47
47 0.5
48 0.61
49 0.69
50 0.76
51 0.78
52 0.8
53 0.81
54 0.8
55 0.78
56 0.78
57 0.75
58 0.73