Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JM67

Protein Details
Accession A0A197JM67    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-46WLRYLRRCRYVQRRRYLQLHQYLQQHRHVQRYRRLQQHRHLQQHRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences WLRYLRRCRYVQRRRYLQLHQYLQQHRHVQRYRRLQQHRHLQQHRCLQQHRYVHWLRYLRRCRYVQQHRYLQLHRYVPWLRYLRRCRYVQRHRYLQLHRYVPWLRYLRRCRYVQQHRYLQLHRYVPWLRCLRRCRYVQQHRYLQLHQYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.82
4 0.8
5 0.79
6 0.75
7 0.7
8 0.69
9 0.69
10 0.66
11 0.64
12 0.64
13 0.58
14 0.62
15 0.64
16 0.63
17 0.65
18 0.72
19 0.73
20 0.75
21 0.8
22 0.79
23 0.8
24 0.83
25 0.83
26 0.83
27 0.83
28 0.79
29 0.78
30 0.79
31 0.77
32 0.72
33 0.66
34 0.6
35 0.59
36 0.59
37 0.52
38 0.51
39 0.47
40 0.43
41 0.45
42 0.47
43 0.45
44 0.49
45 0.56
46 0.53
47 0.57
48 0.57
49 0.56
50 0.6
51 0.66
52 0.65
53 0.64
54 0.66
55 0.64
56 0.66
57 0.63
58 0.55
59 0.5
60 0.43
61 0.35
62 0.34
63 0.31
64 0.27
65 0.32
66 0.34
67 0.31
68 0.39
69 0.46
70 0.48
71 0.53
72 0.59
73 0.6
74 0.66
75 0.74
76 0.74
77 0.75
78 0.75
79 0.73
80 0.75
81 0.72
82 0.68
83 0.65
84 0.58
85 0.5
86 0.48
87 0.44
88 0.37
89 0.39
90 0.37
91 0.33
92 0.39
93 0.46
94 0.48
95 0.53
96 0.55
97 0.53
98 0.59
99 0.66
100 0.66
101 0.66
102 0.65
103 0.64
104 0.66
105 0.63
106 0.55
107 0.5
108 0.43
109 0.35
110 0.34
111 0.35
112 0.32
113 0.4
114 0.45
115 0.46
116 0.52
117 0.59
118 0.62
119 0.65
120 0.68
121 0.69
122 0.71
123 0.77
124 0.77
125 0.78
126 0.76
127 0.73
128 0.73
129 0.66