Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DM47

Protein Details
Accession J9DM47    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKKTLRGSLKNKKKIGPBasic
NLS Segment(s)
PositionSequence
3-18KRKKTLRGSLKNKKKI
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKTLRGSLKNKKKIGPLPTRFSCPECKHENVVSCKVFKKDGIGVAVCKVCEAKHECLASALTKPIDIYSDWVDKSDRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.78
4 0.74
5 0.73
6 0.73
7 0.7
8 0.69
9 0.67
10 0.68
11 0.61
12 0.56
13 0.55
14 0.48
15 0.47
16 0.44
17 0.44
18 0.43
19 0.44
20 0.48
21 0.44
22 0.46
23 0.41
24 0.38
25 0.37
26 0.34
27 0.31
28 0.25
29 0.22
30 0.18
31 0.19
32 0.2
33 0.18
34 0.17
35 0.19
36 0.2
37 0.16
38 0.14
39 0.12
40 0.09
41 0.14
42 0.19
43 0.21
44 0.26
45 0.27
46 0.27
47 0.28
48 0.29
49 0.25
50 0.21
51 0.2
52 0.14
53 0.14
54 0.14
55 0.13
56 0.13
57 0.12
58 0.15
59 0.17
60 0.22
61 0.21
62 0.23