Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DKH1

Protein Details
Accession J9DKH1   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-39DLVKKVEKVKKDRKEILERHFBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031504  DMAP1-like  
Pfam View protein in Pfam  
PF17024  DMAP1_like  
Amino Acid Sequences MSDDEYSEETLEAIQSFIDLVKKVEKVKKDRKEILERHFPELFETKPEAKKDLEIRISEIINKNISHPPVFLASILGFSKSNWNKTVEKMLIDLGLTSRLRYCSYENMQRYEKLKHLILKYIDKKYKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.08
6 0.08
7 0.1
8 0.14
9 0.17
10 0.24
11 0.3
12 0.37
13 0.45
14 0.55
15 0.63
16 0.68
17 0.74
18 0.76
19 0.81
20 0.8
21 0.78
22 0.78
23 0.71
24 0.67
25 0.6
26 0.51
27 0.44
28 0.4
29 0.32
30 0.25
31 0.26
32 0.25
33 0.27
34 0.29
35 0.28
36 0.25
37 0.29
38 0.3
39 0.33
40 0.33
41 0.29
42 0.3
43 0.3
44 0.29
45 0.28
46 0.26
47 0.21
48 0.19
49 0.19
50 0.19
51 0.19
52 0.2
53 0.17
54 0.15
55 0.14
56 0.14
57 0.14
58 0.11
59 0.09
60 0.08
61 0.1
62 0.09
63 0.09
64 0.08
65 0.08
66 0.18
67 0.19
68 0.23
69 0.23
70 0.27
71 0.28
72 0.3
73 0.38
74 0.3
75 0.28
76 0.26
77 0.25
78 0.21
79 0.19
80 0.17
81 0.09
82 0.13
83 0.12
84 0.12
85 0.13
86 0.14
87 0.16
88 0.18
89 0.21
90 0.24
91 0.32
92 0.41
93 0.43
94 0.47
95 0.49
96 0.51
97 0.52
98 0.48
99 0.46
100 0.42
101 0.43
102 0.45
103 0.45
104 0.48
105 0.5
106 0.55
107 0.58
108 0.63
109 0.65