Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DIE6

Protein Details
Accession J9DIE6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-40LTQVRKKKVVSKKNLDDDSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
Amino Acid Sequences MSSSSSEEEWNPVGFDRDTFLTQVRKKKVVSKKNLDDDSDLPSELHYFNLLNRAYTEFANYEEAWNRNISALKLPLDVRREPGNHTSINLIDISEALKREPKHLKSYIEDCLLLHGTVNSKNRLVFNTVVMKNSIQNAIRKYYDTFNMCGSCQKGEDTEIVRENKLSYVRCRLCGGKKHVSVKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.18
6 0.18
7 0.22
8 0.27
9 0.33
10 0.42
11 0.45
12 0.47
13 0.49
14 0.57
15 0.64
16 0.65
17 0.7
18 0.72
19 0.75
20 0.79
21 0.81
22 0.73
23 0.67
24 0.57
25 0.52
26 0.43
27 0.33
28 0.24
29 0.2
30 0.19
31 0.15
32 0.14
33 0.1
34 0.09
35 0.09
36 0.16
37 0.16
38 0.14
39 0.15
40 0.17
41 0.18
42 0.17
43 0.19
44 0.12
45 0.14
46 0.16
47 0.15
48 0.15
49 0.17
50 0.18
51 0.17
52 0.17
53 0.16
54 0.14
55 0.15
56 0.14
57 0.14
58 0.15
59 0.15
60 0.17
61 0.18
62 0.2
63 0.23
64 0.23
65 0.22
66 0.24
67 0.24
68 0.25
69 0.28
70 0.27
71 0.24
72 0.24
73 0.22
74 0.18
75 0.17
76 0.14
77 0.1
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.1
85 0.1
86 0.17
87 0.25
88 0.27
89 0.33
90 0.38
91 0.4
92 0.41
93 0.44
94 0.42
95 0.36
96 0.32
97 0.25
98 0.23
99 0.21
100 0.16
101 0.13
102 0.09
103 0.1
104 0.14
105 0.18
106 0.17
107 0.18
108 0.2
109 0.21
110 0.22
111 0.24
112 0.2
113 0.21
114 0.28
115 0.28
116 0.27
117 0.27
118 0.26
119 0.24
120 0.25
121 0.25
122 0.19
123 0.22
124 0.24
125 0.27
126 0.28
127 0.28
128 0.29
129 0.28
130 0.33
131 0.31
132 0.3
133 0.3
134 0.3
135 0.29
136 0.3
137 0.28
138 0.23
139 0.21
140 0.21
141 0.18
142 0.18
143 0.22
144 0.21
145 0.25
146 0.29
147 0.3
148 0.3
149 0.29
150 0.28
151 0.28
152 0.3
153 0.3
154 0.29
155 0.38
156 0.41
157 0.44
158 0.47
159 0.5
160 0.54
161 0.59
162 0.62
163 0.61
164 0.66
165 0.73