Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JT94

Protein Details
Accession A0A197JT94    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDEASKKRKERLEQLKKRKLESBasic
NLS Segment(s)
PositionSequence
6-19KKRKERLEQLKKRK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013169  mRNA_splic_Cwf18-like  
Pfam View protein in Pfam  
PF08315  cwf18  
Amino Acid Sequences MDEASKKRKERLEQLKKRKLESTGGGDSVSMSFRNYTPVNETLKDQESKITTPADIGDTVEKKMEGVVEKVIQEEDEKRAKDVDIFTLAPKKPNWDLKRDIEPQLLKLEKKTRAAVIELIRKERPQDLSMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.84
4 0.8
5 0.74
6 0.67
7 0.62
8 0.58
9 0.54
10 0.48
11 0.45
12 0.4
13 0.35
14 0.31
15 0.25
16 0.19
17 0.12
18 0.08
19 0.09
20 0.09
21 0.14
22 0.14
23 0.15
24 0.18
25 0.23
26 0.26
27 0.25
28 0.27
29 0.26
30 0.29
31 0.29
32 0.24
33 0.23
34 0.22
35 0.22
36 0.23
37 0.19
38 0.15
39 0.14
40 0.15
41 0.12
42 0.1
43 0.1
44 0.11
45 0.11
46 0.12
47 0.12
48 0.11
49 0.09
50 0.09
51 0.1
52 0.07
53 0.07
54 0.09
55 0.09
56 0.1
57 0.1
58 0.1
59 0.09
60 0.09
61 0.1
62 0.13
63 0.17
64 0.17
65 0.17
66 0.18
67 0.18
68 0.2
69 0.19
70 0.17
71 0.16
72 0.16
73 0.17
74 0.24
75 0.24
76 0.25
77 0.24
78 0.26
79 0.29
80 0.39
81 0.41
82 0.41
83 0.47
84 0.49
85 0.58
86 0.57
87 0.55
88 0.52
89 0.49
90 0.45
91 0.46
92 0.44
93 0.36
94 0.38
95 0.42
96 0.41
97 0.45
98 0.46
99 0.42
100 0.41
101 0.42
102 0.42
103 0.42
104 0.45
105 0.44
106 0.45
107 0.44
108 0.43
109 0.43
110 0.43
111 0.4