Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KI47

Protein Details
Accession A0A197KI47   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-38DDKQCEERTKNKKLRKVQKGRKEDTRTSBasic
NLS Segment(s)
PositionSequence
20-38KNKKLRKVQKGRKEDTRTS
40-47QRIHHGRR
Subcellular Location(s) plas 15, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYKPILVTDHDDKQCEERTKNKKLRKVQKGRKEDTRTSLQRIHHGRRPGRAADMTGPSHPGLACLIALLLQLHHLLPLHLMLQSHPLQLFPLLFFQQPQVLVVLVVLFFLLVRHICAAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.44
4 0.45
5 0.51
6 0.61
7 0.69
8 0.73
9 0.74
10 0.78
11 0.84
12 0.86
13 0.88
14 0.88
15 0.89
16 0.9
17 0.88
18 0.88
19 0.85
20 0.79
21 0.73
22 0.73
23 0.66
24 0.61
25 0.6
26 0.51
27 0.52
28 0.54
29 0.54
30 0.5
31 0.54
32 0.52
33 0.52
34 0.55
35 0.48
36 0.44
37 0.38
38 0.34
39 0.29
40 0.29
41 0.25
42 0.21
43 0.21
44 0.17
45 0.16
46 0.14
47 0.11
48 0.08
49 0.07
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.12
70 0.13
71 0.14
72 0.14
73 0.13
74 0.13
75 0.14
76 0.14
77 0.1
78 0.12
79 0.12
80 0.12
81 0.13
82 0.14
83 0.15
84 0.14
85 0.14
86 0.12
87 0.1
88 0.1
89 0.1
90 0.09
91 0.06
92 0.06
93 0.05
94 0.04
95 0.03
96 0.04
97 0.06
98 0.06
99 0.07