Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D3C5

Protein Details
Accession J9D3C5   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-37IQPENKKKMKGRPAGVKKPVSHydrophilic
56-78YELYESRSKRKPRKNAEEKSVKVHydrophilic
NLS Segment(s)
PositionSequence
22-34KKKMKGRPAGVKK
62-92RSKRKPRKNAEEKSVKVSVKSKVKPNGKGAK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MENKDGKADPTEQKNEIQPENKKKMKGRPAGVKKPVSNSPMPTSTRASAILARKNYELYESRSKRKPRKNAEEKSVKVSVKSKVKPNGKGAKEVADEVKVEDVKKNQKAVSKNNTIKSTSKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.49
4 0.5
5 0.51
6 0.55
7 0.63
8 0.65
9 0.66
10 0.68
11 0.72
12 0.74
13 0.73
14 0.71
15 0.73
16 0.78
17 0.81
18 0.83
19 0.8
20 0.72
21 0.68
22 0.65
23 0.59
24 0.51
25 0.45
26 0.42
27 0.41
28 0.4
29 0.38
30 0.35
31 0.31
32 0.3
33 0.26
34 0.23
35 0.22
36 0.25
37 0.27
38 0.25
39 0.26
40 0.25
41 0.25
42 0.24
43 0.22
44 0.19
45 0.2
46 0.29
47 0.31
48 0.36
49 0.43
50 0.51
51 0.58
52 0.65
53 0.69
54 0.69
55 0.77
56 0.82
57 0.83
58 0.84
59 0.84
60 0.76
61 0.72
62 0.67
63 0.56
64 0.47
65 0.44
66 0.42
67 0.41
68 0.44
69 0.46
70 0.5
71 0.57
72 0.61
73 0.67
74 0.69
75 0.62
76 0.64
77 0.57
78 0.54
79 0.48
80 0.44
81 0.36
82 0.28
83 0.26
84 0.21
85 0.24
86 0.19
87 0.18
88 0.2
89 0.25
90 0.33
91 0.38
92 0.41
93 0.4
94 0.45
95 0.52
96 0.58
97 0.61
98 0.63
99 0.66
100 0.69
101 0.7
102 0.67
103 0.67