Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JNT2

Protein Details
Accession A0A197JNT2   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-41LVLQPKSWSRQLRRQRRQDLNKEKRSKLSHydrophilic
NLS Segment(s)
PositionSequence
26-40RQRRQDLNKEKRSKL
Subcellular Location(s) mito 12, plas 4, E.R. 3, golg 3, nucl 2, cyto 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001542  Defensin_invertebrate/fungal  
IPR036574  Scorpion_toxin-like_sf  
Gene Ontology GO:0006952  P:defense response  
Pfam View protein in Pfam  
PF01097  Defensin_2  
PROSITE View protein in PROSITE  
PS51378  INVERT_DEFENSINS  
Amino Acid Sequences MPWRQDNRYSPPLVLQPKSWSRQLRRQRRQDLNKEKRSKLSKKFLLGVFAVVAVATLATPVTAGFGCPDSQACSNYCKTIDRNGGYCGGFLYHTCKCNQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.4
4 0.45
5 0.48
6 0.51
7 0.52
8 0.52
9 0.6
10 0.69
11 0.72
12 0.75
13 0.82
14 0.85
15 0.87
16 0.9
17 0.91
18 0.92
19 0.91
20 0.91
21 0.88
22 0.81
23 0.78
24 0.77
25 0.75
26 0.73
27 0.72
28 0.68
29 0.63
30 0.66
31 0.58
32 0.52
33 0.43
34 0.34
35 0.23
36 0.17
37 0.13
38 0.08
39 0.06
40 0.03
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.04
51 0.04
52 0.06
53 0.06
54 0.07
55 0.08
56 0.1
57 0.12
58 0.13
59 0.14
60 0.18
61 0.19
62 0.21
63 0.22
64 0.23
65 0.24
66 0.3
67 0.38
68 0.37
69 0.38
70 0.38
71 0.41
72 0.37
73 0.35
74 0.27
75 0.19
76 0.16
77 0.15
78 0.18
79 0.19
80 0.22