Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JG38

Protein Details
Accession A0A197JG38    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
523-545SNSNSNKCRRCSHKSDPLQCYLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 2.5, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021419  Mediator_Med25_VWA  
IPR007730  SPOR-like_dom  
Gene Ontology GO:0042834  F:peptidoglycan binding  
Pfam View protein in Pfam  
PF11265  Med25_VWA  
PROSITE View protein in PROSITE  
PS51724  SPOR  
Amino Acid Sequences MFDQHDELRGNEGPEPERHVVLVADSSPHLTGCRCNANEQYDNYSLSDVSQELLKRSISLSLISPSDHSELTELVTKVNERTFEIVEGAPKALPAHIVKLAGFQLPQPPPPVAPPAVTTPSISETPPATTVTTTATATTNGSNKRTNGTTEPVDLKRETAGSPAATGMSPKLAGPAAKRTKIEDNLSAPTPILSAASAEAEDQKKPLPDSTSAPDSMTVSTGSTTEPPAMSSPALAAGRGLNHPNPPAASQAVPGTMPGHLQPPAGALQNISPQLQAQHLQALKAHHAQLSQQQQQALLQQQQQQLGAQVTTLSNQQAQQQAAAQRQFLIQQAAQAAQAQAQAQAAQQAQLAQAQAQAQAQAQAQAQAQAVQAAQQAQLAQAQAQAQAAQQAQLAQAQTQAAQQAQLAQAQAQAQAAHQNFANQAAKPQQPGASGQEFNMYQQQNHLQPPQQPHLQPATQLQGATSGVGSPVTAKSVAAASPLQRNLGSPAANIASVSPSNNSNNSSNNKYRSNSNSNSNSNSNSNSNKCRRCSHKSDPLQCYLVAFRRYLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.33
4 0.31
5 0.29
6 0.27
7 0.23
8 0.21
9 0.21
10 0.14
11 0.14
12 0.13
13 0.15
14 0.14
15 0.14
16 0.14
17 0.13
18 0.17
19 0.21
20 0.3
21 0.3
22 0.35
23 0.41
24 0.47
25 0.52
26 0.51
27 0.52
28 0.45
29 0.45
30 0.4
31 0.35
32 0.27
33 0.22
34 0.2
35 0.13
36 0.11
37 0.13
38 0.14
39 0.15
40 0.18
41 0.17
42 0.17
43 0.17
44 0.2
45 0.17
46 0.17
47 0.18
48 0.19
49 0.19
50 0.19
51 0.19
52 0.19
53 0.2
54 0.18
55 0.16
56 0.14
57 0.14
58 0.15
59 0.2
60 0.17
61 0.16
62 0.18
63 0.18
64 0.2
65 0.22
66 0.22
67 0.18
68 0.21
69 0.22
70 0.21
71 0.22
72 0.21
73 0.2
74 0.2
75 0.19
76 0.15
77 0.14
78 0.13
79 0.11
80 0.14
81 0.13
82 0.16
83 0.17
84 0.18
85 0.18
86 0.2
87 0.21
88 0.18
89 0.17
90 0.15
91 0.21
92 0.22
93 0.24
94 0.24
95 0.24
96 0.23
97 0.26
98 0.29
99 0.22
100 0.21
101 0.22
102 0.24
103 0.27
104 0.26
105 0.24
106 0.21
107 0.23
108 0.23
109 0.2
110 0.17
111 0.15
112 0.16
113 0.17
114 0.17
115 0.14
116 0.13
117 0.14
118 0.15
119 0.15
120 0.14
121 0.13
122 0.13
123 0.13
124 0.14
125 0.16
126 0.19
127 0.21
128 0.24
129 0.27
130 0.27
131 0.3
132 0.31
133 0.32
134 0.3
135 0.32
136 0.3
137 0.31
138 0.36
139 0.33
140 0.35
141 0.31
142 0.28
143 0.24
144 0.23
145 0.19
146 0.16
147 0.16
148 0.13
149 0.13
150 0.13
151 0.12
152 0.1
153 0.11
154 0.09
155 0.08
156 0.08
157 0.07
158 0.08
159 0.09
160 0.1
161 0.12
162 0.22
163 0.28
164 0.32
165 0.33
166 0.35
167 0.41
168 0.45
169 0.46
170 0.41
171 0.38
172 0.37
173 0.38
174 0.34
175 0.27
176 0.21
177 0.17
178 0.12
179 0.09
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.06
186 0.1
187 0.11
188 0.11
189 0.12
190 0.13
191 0.14
192 0.15
193 0.18
194 0.16
195 0.18
196 0.21
197 0.25
198 0.26
199 0.25
200 0.25
201 0.23
202 0.21
203 0.18
204 0.15
205 0.11
206 0.08
207 0.07
208 0.08
209 0.07
210 0.07
211 0.08
212 0.08
213 0.08
214 0.08
215 0.09
216 0.1
217 0.09
218 0.08
219 0.08
220 0.1
221 0.1
222 0.09
223 0.08
224 0.08
225 0.09
226 0.11
227 0.13
228 0.11
229 0.12
230 0.13
231 0.14
232 0.14
233 0.13
234 0.13
235 0.13
236 0.12
237 0.11
238 0.11
239 0.11
240 0.1
241 0.09
242 0.08
243 0.07
244 0.07
245 0.06
246 0.08
247 0.08
248 0.08
249 0.07
250 0.08
251 0.09
252 0.1
253 0.09
254 0.08
255 0.08
256 0.11
257 0.12
258 0.11
259 0.1
260 0.09
261 0.1
262 0.11
263 0.11
264 0.09
265 0.12
266 0.12
267 0.13
268 0.15
269 0.15
270 0.16
271 0.18
272 0.18
273 0.14
274 0.14
275 0.15
276 0.2
277 0.26
278 0.28
279 0.27
280 0.26
281 0.25
282 0.26
283 0.27
284 0.24
285 0.2
286 0.19
287 0.23
288 0.25
289 0.26
290 0.26
291 0.23
292 0.22
293 0.19
294 0.15
295 0.09
296 0.08
297 0.07
298 0.07
299 0.08
300 0.07
301 0.08
302 0.09
303 0.12
304 0.15
305 0.15
306 0.15
307 0.17
308 0.2
309 0.23
310 0.23
311 0.2
312 0.17
313 0.17
314 0.18
315 0.16
316 0.15
317 0.11
318 0.12
319 0.12
320 0.12
321 0.12
322 0.12
323 0.1
324 0.09
325 0.1
326 0.08
327 0.08
328 0.08
329 0.08
330 0.07
331 0.1
332 0.09
333 0.09
334 0.09
335 0.09
336 0.09
337 0.1
338 0.1
339 0.07
340 0.09
341 0.09
342 0.1
343 0.09
344 0.1
345 0.08
346 0.11
347 0.11
348 0.11
349 0.11
350 0.12
351 0.12
352 0.13
353 0.13
354 0.13
355 0.12
356 0.11
357 0.11
358 0.09
359 0.1
360 0.09
361 0.09
362 0.08
363 0.09
364 0.08
365 0.1
366 0.08
367 0.08
368 0.08
369 0.09
370 0.09
371 0.09
372 0.09
373 0.08
374 0.11
375 0.11
376 0.1
377 0.09
378 0.09
379 0.09
380 0.11
381 0.11
382 0.08
383 0.1
384 0.09
385 0.1
386 0.1
387 0.11
388 0.09
389 0.09
390 0.09
391 0.11
392 0.11
393 0.12
394 0.11
395 0.1
396 0.11
397 0.11
398 0.12
399 0.1
400 0.09
401 0.08
402 0.15
403 0.16
404 0.15
405 0.15
406 0.16
407 0.15
408 0.21
409 0.23
410 0.16
411 0.19
412 0.25
413 0.27
414 0.27
415 0.29
416 0.26
417 0.25
418 0.28
419 0.3
420 0.28
421 0.27
422 0.25
423 0.28
424 0.25
425 0.25
426 0.3
427 0.25
428 0.2
429 0.24
430 0.29
431 0.29
432 0.33
433 0.36
434 0.33
435 0.38
436 0.45
437 0.47
438 0.48
439 0.45
440 0.45
441 0.48
442 0.44
443 0.41
444 0.37
445 0.36
446 0.31
447 0.3
448 0.25
449 0.21
450 0.2
451 0.18
452 0.14
453 0.09
454 0.08
455 0.08
456 0.08
457 0.07
458 0.07
459 0.09
460 0.09
461 0.09
462 0.09
463 0.11
464 0.11
465 0.12
466 0.14
467 0.15
468 0.21
469 0.23
470 0.24
471 0.22
472 0.23
473 0.25
474 0.27
475 0.25
476 0.18
477 0.21
478 0.2
479 0.2
480 0.18
481 0.15
482 0.14
483 0.14
484 0.15
485 0.14
486 0.17
487 0.2
488 0.23
489 0.27
490 0.26
491 0.32
492 0.37
493 0.44
494 0.48
495 0.51
496 0.54
497 0.53
498 0.58
499 0.6
500 0.63
501 0.6
502 0.62
503 0.65
504 0.64
505 0.68
506 0.63
507 0.58
508 0.53
509 0.52
510 0.48
511 0.48
512 0.5
513 0.55
514 0.61
515 0.65
516 0.66
517 0.72
518 0.74
519 0.75
520 0.77
521 0.78
522 0.78
523 0.81
524 0.86
525 0.84
526 0.81
527 0.74
528 0.65
529 0.57
530 0.53
531 0.5
532 0.42
533 0.36