Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JJ64

Protein Details
Accession A0A197JJ64   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
136-159AAKSSQSKKPTTNRRAPPKPSGGGHydrophilic
NLS Segment(s)
PositionSequence
126-167RSNKAKKTKEAAKSSQSKKPTTNRRAPPKPSGGGGKFMKPKE
Subcellular Location(s) mito 14, nucl 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MAEIPHKTALSGKLLTMKFMQRQQEQETRDKLVKEQNRIVTEAHWVIDQTAVDLPKPKFQVDYEPSFLQMTATERSSVGRMSFQKFNSAVEKSASQAAGEQQLERELKRQRQSEISDDEMAKEMGRSNKAKKTKEAAKSSQSKKPTTNRRAPPKPSGGGGKFMKPKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.31
4 0.33
5 0.34
6 0.38
7 0.45
8 0.41
9 0.46
10 0.51
11 0.55
12 0.54
13 0.56
14 0.54
15 0.51
16 0.5
17 0.46
18 0.43
19 0.45
20 0.47
21 0.47
22 0.5
23 0.52
24 0.5
25 0.51
26 0.47
27 0.38
28 0.37
29 0.3
30 0.23
31 0.16
32 0.14
33 0.13
34 0.14
35 0.13
36 0.09
37 0.1
38 0.1
39 0.1
40 0.16
41 0.17
42 0.2
43 0.22
44 0.22
45 0.21
46 0.22
47 0.31
48 0.29
49 0.34
50 0.33
51 0.31
52 0.32
53 0.3
54 0.29
55 0.2
56 0.16
57 0.13
58 0.11
59 0.11
60 0.1
61 0.1
62 0.11
63 0.12
64 0.11
65 0.09
66 0.12
67 0.14
68 0.18
69 0.22
70 0.21
71 0.25
72 0.25
73 0.26
74 0.25
75 0.23
76 0.2
77 0.17
78 0.18
79 0.14
80 0.16
81 0.14
82 0.1
83 0.1
84 0.1
85 0.13
86 0.13
87 0.12
88 0.1
89 0.14
90 0.15
91 0.15
92 0.2
93 0.22
94 0.29
95 0.36
96 0.39
97 0.38
98 0.44
99 0.48
100 0.48
101 0.46
102 0.43
103 0.39
104 0.36
105 0.34
106 0.28
107 0.24
108 0.18
109 0.14
110 0.14
111 0.15
112 0.21
113 0.25
114 0.3
115 0.39
116 0.47
117 0.51
118 0.54
119 0.59
120 0.63
121 0.68
122 0.7
123 0.68
124 0.69
125 0.75
126 0.74
127 0.72
128 0.69
129 0.64
130 0.64
131 0.67
132 0.69
133 0.69
134 0.74
135 0.77
136 0.82
137 0.87
138 0.86
139 0.85
140 0.82
141 0.75
142 0.7
143 0.7
144 0.61
145 0.6
146 0.56
147 0.55