Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JEL4

Protein Details
Accession A0A197JEL4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
168-197VEPEEQRRKRVSKWKRLFRKVFRIKDNERSBasic
NLS Segment(s)
PositionSequence
174-191RRKRVSKWKRLFRKVFRI
Subcellular Location(s) nucl 15.5, cyto_nucl 11.333, cyto 6, cyto_pero 4.333, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013536  WLM_dom  
Pfam View protein in Pfam  
PF08325  WLM  
PROSITE View protein in PROSITE  
PS51397  WLM  
Amino Acid Sequences MANIMTLDKLRVKEARGDVISWEYKPPRGNIWTLQDIRDRDCFGRVSVRGNSEESYKLMMSVVDKVKVIMRRRRWYIDELQELDPGSKYLGLNVGHTLEIHLKLRTWRGPISHNDLVLTMLHELTHIINSSHNDDFYALFYRLKAEYETHYGVKLSTKTRTTQCGNGVEPEEQRRKRVSKWKRLFRKVFRIKDNERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.39
4 0.38
5 0.35
6 0.38
7 0.39
8 0.31
9 0.34
10 0.28
11 0.31
12 0.34
13 0.34
14 0.34
15 0.35
16 0.38
17 0.38
18 0.43
19 0.47
20 0.45
21 0.46
22 0.45
23 0.43
24 0.43
25 0.4
26 0.36
27 0.29
28 0.3
29 0.28
30 0.23
31 0.29
32 0.27
33 0.28
34 0.29
35 0.31
36 0.3
37 0.31
38 0.3
39 0.25
40 0.25
41 0.21
42 0.2
43 0.16
44 0.15
45 0.13
46 0.13
47 0.11
48 0.16
49 0.17
50 0.15
51 0.15
52 0.16
53 0.19
54 0.25
55 0.32
56 0.34
57 0.42
58 0.48
59 0.54
60 0.58
61 0.57
62 0.57
63 0.57
64 0.56
65 0.53
66 0.48
67 0.44
68 0.4
69 0.37
70 0.32
71 0.24
72 0.16
73 0.11
74 0.09
75 0.07
76 0.07
77 0.11
78 0.11
79 0.11
80 0.12
81 0.12
82 0.1
83 0.1
84 0.11
85 0.08
86 0.09
87 0.1
88 0.09
89 0.09
90 0.11
91 0.15
92 0.16
93 0.18
94 0.18
95 0.19
96 0.24
97 0.27
98 0.34
99 0.32
100 0.3
101 0.27
102 0.26
103 0.24
104 0.2
105 0.16
106 0.08
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.08
116 0.1
117 0.14
118 0.14
119 0.14
120 0.13
121 0.13
122 0.14
123 0.14
124 0.15
125 0.12
126 0.12
127 0.12
128 0.14
129 0.14
130 0.15
131 0.14
132 0.13
133 0.16
134 0.21
135 0.24
136 0.23
137 0.23
138 0.22
139 0.21
140 0.24
141 0.24
142 0.22
143 0.25
144 0.27
145 0.32
146 0.36
147 0.43
148 0.43
149 0.45
150 0.47
151 0.47
152 0.46
153 0.44
154 0.43
155 0.39
156 0.39
157 0.41
158 0.45
159 0.42
160 0.44
161 0.48
162 0.5
163 0.56
164 0.63
165 0.65
166 0.67
167 0.76
168 0.82
169 0.86
170 0.92
171 0.94
172 0.93
173 0.93
174 0.93
175 0.91
176 0.9
177 0.89