Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JNL0

Protein Details
Accession A0A197JNL0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-104EKQQGITERRKHKPPEERPRTBasic
NLS Segment(s)
PositionSequence
92-103RRKHKPPEERPR
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MSHRRKPPSTEDRNEGYTGDEKWTVCHILRGLVPKALAAEWAKVFKEMPKSVAEHVSRLFCKYIEKEGREKIWKPRCERTVEWEKQQGITERRKHKPPEERPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.5
3 0.42
4 0.34
5 0.28
6 0.25
7 0.22
8 0.19
9 0.2
10 0.22
11 0.21
12 0.18
13 0.2
14 0.18
15 0.18
16 0.2
17 0.24
18 0.23
19 0.21
20 0.21
21 0.18
22 0.18
23 0.15
24 0.15
25 0.11
26 0.12
27 0.11
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.2
34 0.18
35 0.19
36 0.19
37 0.21
38 0.22
39 0.28
40 0.25
41 0.2
42 0.21
43 0.22
44 0.21
45 0.21
46 0.2
47 0.14
48 0.17
49 0.18
50 0.26
51 0.29
52 0.32
53 0.36
54 0.4
55 0.46
56 0.49
57 0.51
58 0.52
59 0.54
60 0.58
61 0.59
62 0.64
63 0.63
64 0.65
65 0.63
66 0.62
67 0.63
68 0.62
69 0.62
70 0.59
71 0.55
72 0.5
73 0.51
74 0.5
75 0.47
76 0.51
77 0.54
78 0.56
79 0.63
80 0.69
81 0.73
82 0.75
83 0.79
84 0.81