Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JKF1

Protein Details
Accession A0A197JKF1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-75DTTAKRVRSYQQQQRKRDKVEPAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 10, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSFQSYIPETYILQWLASLSIWFLLIGIPLLTISTFCYCLARSTGNVAGVIVDTTAKRVRSYQQQQRKRDKVEPAVEEGRAYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.12
5 0.1
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.03
17 0.04
18 0.03
19 0.03
20 0.05
21 0.06
22 0.07
23 0.07
24 0.08
25 0.08
26 0.1
27 0.11
28 0.11
29 0.1
30 0.12
31 0.14
32 0.13
33 0.13
34 0.12
35 0.1
36 0.09
37 0.09
38 0.06
39 0.05
40 0.04
41 0.07
42 0.1
43 0.11
44 0.11
45 0.14
46 0.19
47 0.29
48 0.4
49 0.48
50 0.56
51 0.65
52 0.74
53 0.83
54 0.87
55 0.83
56 0.8
57 0.79
58 0.78
59 0.77
60 0.71
61 0.67
62 0.62
63 0.56