Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197K7U0

Protein Details
Accession A0A197K7U0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
114-133DIYTDGTIRNRKRRPSRYRMHydrophilic
NLS Segment(s)
PositionSequence
124-129RKRRPS
Subcellular Location(s) mito 10, nucl 6, extr 5, cyto 3, plas 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
PROSITE View protein in PROSITE  
PS50231  RICIN_B_LECTIN  
Amino Acid Sequences MKTVGVFAQFWKILYDAKGAPTWSSGAFHGSADAFRVKALFWQFRDGHMFLTDLDGRTAWASAITRTHTNVQIQAKNQDGSRSGYCAQSMTWNAGNGAAVLLMPCSDDPYQHWDIYTDGTIRNRKRRPSRYRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.17
4 0.19
5 0.21
6 0.21
7 0.2
8 0.19
9 0.19
10 0.15
11 0.16
12 0.13
13 0.14
14 0.13
15 0.13
16 0.13
17 0.12
18 0.11
19 0.11
20 0.12
21 0.09
22 0.09
23 0.09
24 0.08
25 0.12
26 0.18
27 0.21
28 0.21
29 0.28
30 0.29
31 0.31
32 0.36
33 0.32
34 0.27
35 0.22
36 0.21
37 0.14
38 0.17
39 0.16
40 0.12
41 0.11
42 0.1
43 0.1
44 0.09
45 0.09
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.09
52 0.1
53 0.12
54 0.14
55 0.15
56 0.16
57 0.2
58 0.23
59 0.25
60 0.26
61 0.27
62 0.27
63 0.26
64 0.26
65 0.22
66 0.19
67 0.2
68 0.19
69 0.2
70 0.19
71 0.18
72 0.18
73 0.17
74 0.15
75 0.16
76 0.16
77 0.16
78 0.17
79 0.16
80 0.16
81 0.16
82 0.16
83 0.11
84 0.1
85 0.06
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.08
93 0.08
94 0.09
95 0.11
96 0.19
97 0.22
98 0.22
99 0.23
100 0.2
101 0.21
102 0.23
103 0.23
104 0.17
105 0.18
106 0.25
107 0.33
108 0.4
109 0.5
110 0.54
111 0.63
112 0.72
113 0.8