Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KBT3

Protein Details
Accession A0A197KBT3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
62-91DKDRNERIRKSKRLWARKTRLRRKAEEAALBasic
NLS Segment(s)
PositionSequence
57-86GRIKDDKDRNERIRKSKRLWARKTRLRRKA
Subcellular Location(s) mito 15.5, mito_nucl 13.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MKPVPTTTQLLLCPVCSQAFKPSKNENSNLRRHIKDIHKMSPTMHPRKCKWDSIPGGRIKDDKDRNERIRKSKRLWARKTRLRRKAEEAALGLCMLSQTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.17
5 0.23
6 0.31
7 0.33
8 0.38
9 0.45
10 0.53
11 0.58
12 0.62
13 0.61
14 0.61
15 0.67
16 0.68
17 0.66
18 0.57
19 0.54
20 0.57
21 0.55
22 0.56
23 0.54
24 0.53
25 0.49
26 0.48
27 0.48
28 0.48
29 0.5
30 0.5
31 0.48
32 0.48
33 0.48
34 0.56
35 0.58
36 0.55
37 0.49
38 0.49
39 0.52
40 0.52
41 0.58
42 0.53
43 0.51
44 0.47
45 0.45
46 0.38
47 0.4
48 0.4
49 0.4
50 0.43
51 0.5
52 0.58
53 0.66
54 0.71
55 0.73
56 0.76
57 0.77
58 0.75
59 0.75
60 0.77
61 0.78
62 0.81
63 0.81
64 0.82
65 0.83
66 0.89
67 0.91
68 0.91
69 0.88
70 0.85
71 0.82
72 0.81
73 0.76
74 0.71
75 0.62
76 0.53
77 0.46
78 0.39
79 0.3
80 0.2