Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9A0A5

Protein Details
Accession J9A0A5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-142APAGNKPKKGGKGGKKKKKGGKKBasic
NLS Segment(s)
PositionSequence
120-142APAGNKPKKGGKGGKKKKKGGKK
Subcellular Location(s) extr 15, mito 4, E.R. 3, nucl 1, cyto 1, plas 1, cyto_nucl 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MRTFEIASLLLCVLSTFVLAGQPEEAAPPADKEKESASAPADKEKEKEGAPAPEQPAPEQGAPPADQPQGPPAPGPEGPQGPPPGMGPQGPPAPGPGPQMPQVPQGPAQPPVGGPAPEPAPAGNKPKKGGKGGKKKKKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.04
5 0.06
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.08
12 0.09
13 0.08
14 0.09
15 0.1
16 0.13
17 0.15
18 0.15
19 0.16
20 0.18
21 0.2
22 0.2
23 0.21
24 0.2
25 0.23
26 0.24
27 0.29
28 0.29
29 0.27
30 0.27
31 0.27
32 0.28
33 0.22
34 0.26
35 0.23
36 0.26
37 0.26
38 0.3
39 0.29
40 0.29
41 0.29
42 0.26
43 0.24
44 0.22
45 0.2
46 0.15
47 0.14
48 0.13
49 0.13
50 0.13
51 0.14
52 0.12
53 0.12
54 0.12
55 0.15
56 0.14
57 0.14
58 0.13
59 0.11
60 0.13
61 0.13
62 0.15
63 0.14
64 0.15
65 0.15
66 0.18
67 0.19
68 0.16
69 0.16
70 0.14
71 0.13
72 0.13
73 0.13
74 0.1
75 0.13
76 0.15
77 0.15
78 0.14
79 0.14
80 0.14
81 0.16
82 0.19
83 0.17
84 0.18
85 0.2
86 0.23
87 0.22
88 0.26
89 0.26
90 0.24
91 0.24
92 0.25
93 0.25
94 0.25
95 0.25
96 0.2
97 0.19
98 0.2
99 0.21
100 0.17
101 0.15
102 0.16
103 0.16
104 0.17
105 0.17
106 0.15
107 0.17
108 0.21
109 0.3
110 0.34
111 0.37
112 0.41
113 0.48
114 0.54
115 0.59
116 0.65
117 0.66
118 0.71
119 0.77
120 0.84
121 0.86
122 0.9