Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197KB67

Protein Details
Accession A0A197KB67    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-35RKKYIGRRANYGTKKRRARLDRGWKVWKSBasic
NLS Segment(s)
PositionSequence
6-39ERKKYIGRRANYGTKKRRARLDRGWKVWKSRKQK
Subcellular Location(s) plas 10, nucl 7, mito_nucl 6.833, cyto_nucl 5.833, mito 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVITKERKKYIGRRANYGTKKRRARLDRGWKVWKSRKQKDYSWSQQKSKKKVEEGANTQHPIVCLIFFLCSPLKLNPVLLLFPGALDENRKNKRASSPFVVVFLVPSFWSDFHEVFRTLSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.77
4 0.78
5 0.77
6 0.77
7 0.82
8 0.8
9 0.82
10 0.79
11 0.79
12 0.79
13 0.81
14 0.81
15 0.8
16 0.83
17 0.77
18 0.79
19 0.79
20 0.77
21 0.76
22 0.76
23 0.77
24 0.74
25 0.76
26 0.74
27 0.75
28 0.76
29 0.76
30 0.73
31 0.71
32 0.73
33 0.75
34 0.76
35 0.74
36 0.7
37 0.63
38 0.64
39 0.65
40 0.65
41 0.63
42 0.61
43 0.57
44 0.51
45 0.47
46 0.4
47 0.31
48 0.24
49 0.18
50 0.11
51 0.06
52 0.06
53 0.06
54 0.05
55 0.08
56 0.07
57 0.07
58 0.09
59 0.1
60 0.12
61 0.12
62 0.12
63 0.12
64 0.13
65 0.12
66 0.11
67 0.11
68 0.09
69 0.08
70 0.09
71 0.07
72 0.06
73 0.1
74 0.15
75 0.23
76 0.29
77 0.32
78 0.32
79 0.35
80 0.45
81 0.48
82 0.5
83 0.48
84 0.5
85 0.48
86 0.49
87 0.46
88 0.36
89 0.29
90 0.23
91 0.17
92 0.1
93 0.1
94 0.1
95 0.1
96 0.13
97 0.16
98 0.16
99 0.19
100 0.23
101 0.23
102 0.22