Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JCC2

Protein Details
Accession A0A197JCC2    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-95HQKVTIFKMRRRKHYQRHAGHRQNYTEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, mito 10, cyto_nucl 8.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
IPR001787  Ribosomal_L21  
IPR018258  Ribosomal_L21_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
PROSITE View protein in PROSITE  
PS01169  RIBOSOMAL_L21  
Amino Acid Sequences MYAVIKTGGKQYKVAAGEKLKIEQIPADIGAEVTLDQVLAIGEGESIRFGAPLVSGASVKATVVAQGRHQKVTIFKMRRRKHYQRHAGHRQNYTEVRIDAING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.32
4 0.35
5 0.36
6 0.36
7 0.31
8 0.27
9 0.26
10 0.2
11 0.18
12 0.15
13 0.13
14 0.12
15 0.1
16 0.09
17 0.09
18 0.07
19 0.06
20 0.05
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.09
51 0.09
52 0.15
53 0.23
54 0.25
55 0.25
56 0.26
57 0.26
58 0.28
59 0.35
60 0.4
61 0.4
62 0.45
63 0.54
64 0.61
65 0.7
66 0.76
67 0.79
68 0.8
69 0.83
70 0.88
71 0.87
72 0.91
73 0.92
74 0.92
75 0.89
76 0.85
77 0.77
78 0.75
79 0.68
80 0.61
81 0.55
82 0.45
83 0.39