Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197KCB3

Protein Details
Accession A0A197KCB3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-81PTPGHPKPKDPKPKPAPHKPNKPGNTKEWBasic
NLS Segment(s)
PositionSequence
56-75GHPKPKDPKPKPAPHKPNKP
Subcellular Location(s) extr 22, golg 2, mito 1, plas 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MKFSSSSIVLSLLVSLTLLQSTLSLPVPEPSASFSSLEVRAAEPVDALAGAAPTPGHPKPKDPKPKPAPHKPNKPGNTKEWMCTGNTLASIVVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.07
10 0.08
11 0.08
12 0.08
13 0.09
14 0.11
15 0.11
16 0.11
17 0.12
18 0.13
19 0.13
20 0.13
21 0.13
22 0.14
23 0.15
24 0.15
25 0.13
26 0.11
27 0.11
28 0.11
29 0.1
30 0.07
31 0.06
32 0.05
33 0.04
34 0.04
35 0.03
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.07
42 0.09
43 0.15
44 0.16
45 0.24
46 0.32
47 0.43
48 0.54
49 0.55
50 0.65
51 0.69
52 0.79
53 0.81
54 0.84
55 0.85
56 0.84
57 0.91
58 0.88
59 0.88
60 0.86
61 0.86
62 0.8
63 0.75
64 0.74
65 0.65
66 0.59
67 0.54
68 0.48
69 0.4
70 0.37
71 0.33
72 0.25
73 0.23
74 0.21
75 0.16