Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JR07

Protein Details
Accession A0A197JR07    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
185-205SAVFKKRKGGVGKPRNIRRKLBasic
NLS Segment(s)
PositionSequence
189-205KKRKGGVGKPRNIRRKL
Subcellular Location(s) cyto 15, cyto_nucl 14.333, nucl 11.5, mito_nucl 6.666
Family & Domain DBs
Amino Acid Sequences MDKQMDAIEKAAMRQYQLDVEAGLVQPTAAMKAAQSEATSSAAKSSTKDSELIPTGLLKLSSTPTPAPAPETTTTDTAIADVSGEGRTDVGSGTEPVAAIAPVKAKKDETIGQPGEWETVDVHNVSSSQQNKKDTKDGPSSVIVDEDEDVAGNPEDLRRFKIVEKTYPLDDDDLAGEGEGAGGGSAVFKKRKGGVGKPRNIRRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.21
5 0.2
6 0.15
7 0.15
8 0.16
9 0.14
10 0.12
11 0.09
12 0.07
13 0.07
14 0.07
15 0.08
16 0.06
17 0.06
18 0.06
19 0.09
20 0.1
21 0.11
22 0.11
23 0.11
24 0.12
25 0.15
26 0.15
27 0.12
28 0.13
29 0.14
30 0.14
31 0.14
32 0.17
33 0.18
34 0.19
35 0.21
36 0.2
37 0.24
38 0.26
39 0.25
40 0.21
41 0.17
42 0.17
43 0.16
44 0.15
45 0.1
46 0.08
47 0.1
48 0.1
49 0.13
50 0.12
51 0.14
52 0.15
53 0.15
54 0.18
55 0.16
56 0.2
57 0.19
58 0.22
59 0.21
60 0.21
61 0.21
62 0.18
63 0.17
64 0.13
65 0.11
66 0.08
67 0.06
68 0.05
69 0.05
70 0.04
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.06
82 0.06
83 0.05
84 0.06
85 0.05
86 0.04
87 0.05
88 0.07
89 0.09
90 0.1
91 0.11
92 0.11
93 0.12
94 0.15
95 0.19
96 0.19
97 0.25
98 0.25
99 0.24
100 0.25
101 0.24
102 0.21
103 0.17
104 0.14
105 0.07
106 0.07
107 0.08
108 0.07
109 0.07
110 0.06
111 0.07
112 0.07
113 0.12
114 0.16
115 0.21
116 0.26
117 0.34
118 0.36
119 0.4
120 0.46
121 0.44
122 0.46
123 0.48
124 0.44
125 0.41
126 0.4
127 0.38
128 0.31
129 0.29
130 0.22
131 0.15
132 0.13
133 0.1
134 0.08
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.11
143 0.12
144 0.16
145 0.16
146 0.19
147 0.22
148 0.31
149 0.34
150 0.37
151 0.43
152 0.43
153 0.44
154 0.43
155 0.41
156 0.34
157 0.29
158 0.23
159 0.17
160 0.14
161 0.11
162 0.09
163 0.08
164 0.06
165 0.06
166 0.05
167 0.04
168 0.03
169 0.03
170 0.03
171 0.04
172 0.06
173 0.12
174 0.14
175 0.15
176 0.21
177 0.25
178 0.33
179 0.4
180 0.48
181 0.54
182 0.63
183 0.72
184 0.78
185 0.84