Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D248

Protein Details
Accession J9D248    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-109EEEKTLQKQKKDFDRKRLVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.833, nucl 13.5, cyto 11, cyto_pero 6.499
Family & Domain DBs
Amino Acid Sequences MTDNDADKNKNEENTENDLNDKSLKKECPTRLVCGDVVFKENETGFFKNNSSFELVSSKKLGGLENTDKPVVVLKTSKESNDDKEIKKIEEEKTLQKQKKDFDRKRLVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.38
4 0.37
5 0.33
6 0.31
7 0.32
8 0.27
9 0.23
10 0.26
11 0.29
12 0.31
13 0.39
14 0.43
15 0.48
16 0.49
17 0.51
18 0.48
19 0.47
20 0.43
21 0.37
22 0.35
23 0.26
24 0.25
25 0.19
26 0.17
27 0.15
28 0.14
29 0.14
30 0.15
31 0.15
32 0.15
33 0.16
34 0.17
35 0.18
36 0.18
37 0.17
38 0.15
39 0.14
40 0.14
41 0.17
42 0.17
43 0.16
44 0.17
45 0.16
46 0.14
47 0.15
48 0.15
49 0.11
50 0.16
51 0.2
52 0.22
53 0.24
54 0.23
55 0.22
56 0.21
57 0.24
58 0.18
59 0.15
60 0.14
61 0.14
62 0.2
63 0.22
64 0.22
65 0.23
66 0.26
67 0.29
68 0.36
69 0.42
70 0.38
71 0.44
72 0.46
73 0.42
74 0.45
75 0.45
76 0.39
77 0.41
78 0.44
79 0.45
80 0.53
81 0.62
82 0.62
83 0.63
84 0.65
85 0.65
86 0.73
87 0.75
88 0.74
89 0.75