Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197K2B2

Protein Details
Accession A0A197K2B2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-70EGNQCGGKREKEKRREEKERDGKIRKEEKEBasic
NLS Segment(s)
PositionSequence
48-72KREKEKRREEKERDGKIRKEEKERK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MLRNCQRCRVMKESELTWDSKNKERNVLRMNMKADVLSDREGNQCGGKREKEKRREEKERDGKIRKEEKERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.41
4 0.37
5 0.36
6 0.34
7 0.37
8 0.42
9 0.37
10 0.44
11 0.44
12 0.5
13 0.5
14 0.54
15 0.52
16 0.5
17 0.5
18 0.42
19 0.39
20 0.31
21 0.26
22 0.2
23 0.16
24 0.12
25 0.11
26 0.11
27 0.12
28 0.13
29 0.13
30 0.14
31 0.16
32 0.19
33 0.24
34 0.27
35 0.35
36 0.45
37 0.54
38 0.61
39 0.69
40 0.76
41 0.81
42 0.87
43 0.86
44 0.87
45 0.88
46 0.89
47 0.88
48 0.86
49 0.82
50 0.81
51 0.83
52 0.79