Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197J9X4

Protein Details
Accession A0A197J9X4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MVYKPSTKQHQRENWNKIKGTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 9.333, nucl 7.5, cyto_nucl 6.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025494  DUF4385  
Pfam View protein in Pfam  
PF14328  DUF4385  
Amino Acid Sequences MVYKPSTKQHQRENWNKIKGTYSWNSETDYQLHPEEYKVGKGEQGVLLCEPYKSEILPHWRFKDASVAEISSAKIFELFQAYLEKKDFVGADMARKFLQMGYTRARRYANHAGGKKYDLQSGEELPRAPEDPVKAESAAIFYKKWQAAENHALYKGMKQDWKKNYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.78
4 0.69
5 0.64
6 0.56
7 0.54
8 0.49
9 0.46
10 0.43
11 0.42
12 0.43
13 0.4
14 0.39
15 0.34
16 0.31
17 0.27
18 0.23
19 0.23
20 0.21
21 0.2
22 0.23
23 0.21
24 0.2
25 0.19
26 0.18
27 0.18
28 0.18
29 0.2
30 0.17
31 0.16
32 0.15
33 0.14
34 0.15
35 0.13
36 0.13
37 0.1
38 0.1
39 0.1
40 0.09
41 0.1
42 0.14
43 0.23
44 0.3
45 0.36
46 0.36
47 0.38
48 0.39
49 0.38
50 0.42
51 0.32
52 0.28
53 0.23
54 0.2
55 0.18
56 0.19
57 0.19
58 0.1
59 0.1
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.11
68 0.12
69 0.13
70 0.14
71 0.14
72 0.11
73 0.12
74 0.11
75 0.08
76 0.12
77 0.1
78 0.16
79 0.16
80 0.17
81 0.16
82 0.16
83 0.15
84 0.12
85 0.16
86 0.14
87 0.17
88 0.23
89 0.29
90 0.3
91 0.33
92 0.34
93 0.3
94 0.36
95 0.42
96 0.43
97 0.46
98 0.49
99 0.48
100 0.48
101 0.5
102 0.47
103 0.38
104 0.33
105 0.26
106 0.25
107 0.24
108 0.27
109 0.27
110 0.24
111 0.22
112 0.2
113 0.21
114 0.19
115 0.18
116 0.17
117 0.16
118 0.18
119 0.2
120 0.21
121 0.19
122 0.19
123 0.18
124 0.18
125 0.19
126 0.17
127 0.15
128 0.15
129 0.23
130 0.24
131 0.25
132 0.27
133 0.28
134 0.34
135 0.43
136 0.47
137 0.44
138 0.42
139 0.42
140 0.38
141 0.38
142 0.36
143 0.33
144 0.34
145 0.37
146 0.46