Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197K3N2

Protein Details
Accession A0A197K3N2    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-56SPSHGPTPQSRKPRKNCQPTLRKKCSAFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MKKTNLFLFKWPPTTTIDKETDNEKTPTSPSHGPTPQSRKPRKNCQPTLRKKCSAFVEWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.4
4 0.38
5 0.34
6 0.34
7 0.36
8 0.35
9 0.32
10 0.3
11 0.24
12 0.22
13 0.21
14 0.21
15 0.23
16 0.22
17 0.2
18 0.26
19 0.28
20 0.3
21 0.36
22 0.43
23 0.46
24 0.53
25 0.61
26 0.64
27 0.7
28 0.79
29 0.82
30 0.85
31 0.88
32 0.88
33 0.89
34 0.91
35 0.93
36 0.91
37 0.88
38 0.8
39 0.77
40 0.73