Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197K4B4

Protein Details
Accession A0A197K4B4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-26VDYIKRQSFKPGKNQNCNLRRHLHydrophilic
57-83RQERIRKSKRLWARKYRLRRKAEVEEABasic
NLS Segment(s)
PositionSequence
28-77TIHKISPKLHPAKSKWDSIPGGRVKNEKERQERIRKSKRLWARKYRLRRK
Subcellular Location(s) nucl 21, mito_nucl 13.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MTLVDYIKRQSFKPGKNQNCNLRRHLKTIHKISPKLHPAKSKWDSIPGGRVKNEKERQERIRKSKRLWARKYRLRRKAEVEEAASVLCMISDRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.76
4 0.84
5 0.83
6 0.82
7 0.8
8 0.77
9 0.76
10 0.69
11 0.64
12 0.64
13 0.63
14 0.64
15 0.68
16 0.69
17 0.67
18 0.67
19 0.64
20 0.64
21 0.64
22 0.61
23 0.57
24 0.55
25 0.5
26 0.57
27 0.58
28 0.54
29 0.45
30 0.45
31 0.42
32 0.36
33 0.41
34 0.35
35 0.34
36 0.31
37 0.33
38 0.3
39 0.38
40 0.44
41 0.44
42 0.47
43 0.53
44 0.6
45 0.68
46 0.74
47 0.75
48 0.79
49 0.78
50 0.75
51 0.76
52 0.78
53 0.78
54 0.79
55 0.79
56 0.79
57 0.82
58 0.89
59 0.91
60 0.9
61 0.87
62 0.84
63 0.81
64 0.8
65 0.79
66 0.74
67 0.66
68 0.58
69 0.51
70 0.44
71 0.35
72 0.25
73 0.16
74 0.1