Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DC35

Protein Details
Accession J9DC35    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-28KGGKQDPAKHTKKREQTHALKPCVBasic
NLS Segment(s)
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00125  Histone  
Amino Acid Sequences MAQGKGGKQDPAKHTKKREQTHALKPCVLKAGQMKLLIKNLSNLRCSKEASRAAVFAVEYLMHEIIEGANSVAAGSNKKKIQPKHLNAAIRMDCELYRIGHKWLIKSGGTTAHLREEKSKKGKEGCPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.79
4 0.79
5 0.81
6 0.81
7 0.81
8 0.83
9 0.83
10 0.78
11 0.73
12 0.65
13 0.57
14 0.52
15 0.43
16 0.36
17 0.32
18 0.34
19 0.33
20 0.36
21 0.36
22 0.34
23 0.38
24 0.35
25 0.29
26 0.29
27 0.31
28 0.3
29 0.32
30 0.3
31 0.3
32 0.31
33 0.33
34 0.3
35 0.32
36 0.32
37 0.32
38 0.32
39 0.28
40 0.26
41 0.24
42 0.22
43 0.14
44 0.1
45 0.06
46 0.05
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.05
61 0.07
62 0.09
63 0.14
64 0.16
65 0.21
66 0.28
67 0.31
68 0.42
69 0.5
70 0.54
71 0.59
72 0.64
73 0.63
74 0.58
75 0.61
76 0.52
77 0.42
78 0.37
79 0.28
80 0.22
81 0.19
82 0.19
83 0.13
84 0.15
85 0.15
86 0.17
87 0.2
88 0.23
89 0.23
90 0.26
91 0.29
92 0.26
93 0.26
94 0.26
95 0.27
96 0.28
97 0.28
98 0.25
99 0.3
100 0.32
101 0.32
102 0.39
103 0.4
104 0.47
105 0.55
106 0.59
107 0.58
108 0.65