Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DBM7

Protein Details
Accession J9DBM7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-50MVYRERTKSKILNNKKRFKEIMHydrophilic
156-180PSYILRKYRTWQRKQTYKKPFWLDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MIKKIISTVLNYFDIFYSGIRKQLPLLHMVYRERTKSKILNNKKRFKEIMIGNILEPYKQPIKYLVRSEKTNKNLAKIRMPKRRQTLKTVPVQRIIEKDCDDKTKADNEGFFDCQNESNATCEFFDCIDYVNEQEKSKIKNITLKAINHIFCTINPSYILRKYRTWQRKQTYKKPFWLDPVQLKLFNKFGVSDESDDVDSNQNLQEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.15
4 0.16
5 0.15
6 0.19
7 0.19
8 0.2
9 0.21
10 0.26
11 0.27
12 0.26
13 0.28
14 0.28
15 0.32
16 0.34
17 0.38
18 0.38
19 0.42
20 0.4
21 0.39
22 0.41
23 0.43
24 0.5
25 0.54
26 0.6
27 0.67
28 0.74
29 0.82
30 0.81
31 0.82
32 0.75
33 0.67
34 0.64
35 0.58
36 0.56
37 0.51
38 0.46
39 0.38
40 0.39
41 0.36
42 0.27
43 0.23
44 0.19
45 0.19
46 0.18
47 0.19
48 0.23
49 0.29
50 0.35
51 0.44
52 0.48
53 0.47
54 0.52
55 0.58
56 0.59
57 0.57
58 0.6
59 0.52
60 0.49
61 0.52
62 0.5
63 0.53
64 0.54
65 0.6
66 0.62
67 0.66
68 0.67
69 0.7
70 0.77
71 0.71
72 0.71
73 0.7
74 0.67
75 0.71
76 0.71
77 0.63
78 0.59
79 0.57
80 0.49
81 0.43
82 0.38
83 0.32
84 0.27
85 0.27
86 0.22
87 0.24
88 0.24
89 0.21
90 0.21
91 0.21
92 0.21
93 0.2
94 0.19
95 0.19
96 0.2
97 0.2
98 0.18
99 0.16
100 0.14
101 0.14
102 0.14
103 0.12
104 0.1
105 0.1
106 0.11
107 0.11
108 0.1
109 0.1
110 0.09
111 0.08
112 0.09
113 0.07
114 0.08
115 0.08
116 0.08
117 0.1
118 0.13
119 0.15
120 0.14
121 0.17
122 0.2
123 0.23
124 0.27
125 0.3
126 0.28
127 0.34
128 0.35
129 0.41
130 0.43
131 0.41
132 0.42
133 0.44
134 0.42
135 0.36
136 0.36
137 0.28
138 0.22
139 0.27
140 0.22
141 0.17
142 0.17
143 0.18
144 0.21
145 0.27
146 0.32
147 0.29
148 0.32
149 0.37
150 0.47
151 0.56
152 0.61
153 0.65
154 0.7
155 0.77
156 0.84
157 0.88
158 0.89
159 0.86
160 0.86
161 0.83
162 0.77
163 0.75
164 0.73
165 0.7
166 0.66
167 0.66
168 0.6
169 0.58
170 0.54
171 0.5
172 0.44
173 0.38
174 0.31
175 0.24
176 0.22
177 0.24
178 0.26
179 0.25
180 0.24
181 0.25
182 0.25
183 0.24
184 0.24
185 0.23
186 0.2
187 0.18