Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197K432

Protein Details
Accession A0A197K432   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-60FYILKRRRLPREMARRKNKKKKEAGERGEGBasic
NLS Segment(s)
PositionSequence
35-55KRRRLPREMARRKNKKKKEAG
Subcellular Location(s) nucl 12.5, cyto_nucl 9.333, mito 6.5, cyto_mito 6.333, cyto 5
Family & Domain DBs
Amino Acid Sequences MAYLTTWRGVNYTEGQSLEQKHVLLFFEREFYILKRRRLPREMARRKNKKKKEAGERGEGTSTCVCLHGGLSLYLNSNNPSWVLPSLMLSVSLFVGMIHGHGVPWLNCILLHLHLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.28
4 0.29
5 0.29
6 0.26
7 0.22
8 0.2
9 0.2
10 0.2
11 0.18
12 0.18
13 0.14
14 0.15
15 0.15
16 0.16
17 0.15
18 0.16
19 0.24
20 0.29
21 0.34
22 0.4
23 0.48
24 0.55
25 0.59
26 0.65
27 0.65
28 0.7
29 0.75
30 0.77
31 0.8
32 0.83
33 0.9
34 0.92
35 0.91
36 0.9
37 0.89
38 0.87
39 0.88
40 0.87
41 0.81
42 0.79
43 0.71
44 0.63
45 0.54
46 0.45
47 0.36
48 0.25
49 0.21
50 0.12
51 0.11
52 0.09
53 0.08
54 0.08
55 0.06
56 0.07
57 0.06
58 0.07
59 0.07
60 0.08
61 0.09
62 0.09
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.1
69 0.1
70 0.11
71 0.09
72 0.1
73 0.11
74 0.11
75 0.11
76 0.09
77 0.09
78 0.08
79 0.07
80 0.06
81 0.04
82 0.05
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.09
90 0.09
91 0.11
92 0.11
93 0.1
94 0.1
95 0.12
96 0.13