Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KDC4

Protein Details
Accession A0A197KDC4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
3-27HIHKPFKRPGWHASKKTKNLKQIITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MAHIHKPFKRPGWHASKKTKNLKQIITADKAKEWKTNTPTYWNIEALPSMTPQKKYCDITGLEARYTDPKTRLRYHSTEVYQLIKNQPIGVVQQYLGLRNAAVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.81
4 0.83
5 0.88
6 0.85
7 0.83
8 0.8
9 0.75
10 0.72
11 0.7
12 0.67
13 0.62
14 0.59
15 0.51
16 0.47
17 0.48
18 0.41
19 0.38
20 0.35
21 0.37
22 0.38
23 0.43
24 0.42
25 0.43
26 0.44
27 0.44
28 0.43
29 0.36
30 0.3
31 0.24
32 0.22
33 0.17
34 0.14
35 0.1
36 0.12
37 0.14
38 0.16
39 0.17
40 0.21
41 0.24
42 0.26
43 0.25
44 0.26
45 0.24
46 0.27
47 0.31
48 0.29
49 0.24
50 0.22
51 0.22
52 0.22
53 0.23
54 0.22
55 0.21
56 0.26
57 0.32
58 0.38
59 0.44
60 0.46
61 0.49
62 0.51
63 0.55
64 0.51
65 0.49
66 0.45
67 0.43
68 0.38
69 0.37
70 0.36
71 0.3
72 0.29
73 0.25
74 0.23
75 0.2
76 0.21
77 0.2
78 0.17
79 0.14
80 0.18
81 0.19
82 0.2
83 0.2
84 0.18
85 0.15
86 0.13