Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KC81

Protein Details
Accession A0A197KC81   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-47VKEYRRKYFPKQKKVVDKALHydrophilic
67-86EFLLHWRKSKIRSRSKRRVVHydrophilic
NLS Segment(s)
PositionSequence
73-84RKSKIRSRSKRR
Subcellular Location(s) cyto_nucl 10.833, nucl 10, mito_nucl 9.999, mito 8.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MSYLIPGFRKTHNVFPKQIYFTATKEEVKEYRRKYFPKQKKVVDKALAKKMGWGLNDEEEDVGGEDEFLLHWRKSKIRSRSKRRVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.62
4 0.57
5 0.54
6 0.47
7 0.4
8 0.35
9 0.37
10 0.33
11 0.28
12 0.25
13 0.28
14 0.29
15 0.31
16 0.39
17 0.37
18 0.43
19 0.48
20 0.51
21 0.57
22 0.64
23 0.69
24 0.72
25 0.76
26 0.75
27 0.79
28 0.8
29 0.78
30 0.74
31 0.7
32 0.66
33 0.65
34 0.6
35 0.5
36 0.45
37 0.42
38 0.37
39 0.31
40 0.26
41 0.21
42 0.2
43 0.21
44 0.19
45 0.15
46 0.12
47 0.12
48 0.1
49 0.08
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.06
56 0.09
57 0.09
58 0.14
59 0.18
60 0.24
61 0.33
62 0.42
63 0.51
64 0.59
65 0.71
66 0.77