Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KFQ0

Protein Details
Accession A0A197KFQ0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSNFKIRRHKYPLGKQCPVTHydrophilic
354-374SDATPRCRCQCPQNRVRQSAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 6, mito_nucl 6, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011043  Gal_Oxase/kelch_b-propeller  
IPR015915  Kelch-typ_b-propeller  
Pfam View protein in Pfam  
PF13418  Kelch_4  
Amino Acid Sequences MSNFKIRRHKYPLGKQCPVTTRSSSPLVQLFLIAVATSAILPNPALAQTPVPVCCMATAISDDSYLYIQGGFTTTATLRTAVPQFVALDLAVEIWSTSSPPWKWLPSIGGTPPPTSTWHSMAVSKDRGNLFIWDPFQTNAWWTYNIGARYWTSYYIPLNVTMQPGIRSGVDMNTGIVFIPGGADNGTQMIMNTPGNSSVPLTLMPTTILPAPVVRASFVWSTYRNSFLHYGGQSIAGNISNPNLIEFSPTAGWQAVNTTGPSPGDVSGHSYNGTKMIVFGGAGLNGVTNADIHILDMPTREWTLGKSANATHARRNMACATSGDSFVAWGVVSRTRMAPRLSMISGITNGQTCSDATPRCRCQCPQNRVRQSAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.78
4 0.76
5 0.69
6 0.64
7 0.58
8 0.53
9 0.5
10 0.52
11 0.44
12 0.41
13 0.41
14 0.37
15 0.31
16 0.27
17 0.22
18 0.17
19 0.16
20 0.11
21 0.07
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.07
32 0.08
33 0.09
34 0.1
35 0.12
36 0.15
37 0.16
38 0.17
39 0.16
40 0.15
41 0.14
42 0.14
43 0.12
44 0.11
45 0.12
46 0.12
47 0.12
48 0.12
49 0.12
50 0.12
51 0.11
52 0.1
53 0.08
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.09
61 0.09
62 0.1
63 0.11
64 0.12
65 0.11
66 0.15
67 0.17
68 0.16
69 0.16
70 0.15
71 0.15
72 0.14
73 0.14
74 0.1
75 0.08
76 0.07
77 0.07
78 0.05
79 0.05
80 0.05
81 0.04
82 0.05
83 0.05
84 0.05
85 0.12
86 0.12
87 0.16
88 0.2
89 0.22
90 0.23
91 0.25
92 0.28
93 0.25
94 0.28
95 0.27
96 0.3
97 0.29
98 0.29
99 0.27
100 0.25
101 0.25
102 0.25
103 0.26
104 0.22
105 0.24
106 0.25
107 0.26
108 0.28
109 0.31
110 0.31
111 0.29
112 0.31
113 0.27
114 0.28
115 0.26
116 0.26
117 0.21
118 0.21
119 0.21
120 0.18
121 0.19
122 0.17
123 0.17
124 0.15
125 0.14
126 0.14
127 0.14
128 0.13
129 0.12
130 0.14
131 0.17
132 0.17
133 0.16
134 0.15
135 0.14
136 0.16
137 0.16
138 0.15
139 0.12
140 0.14
141 0.15
142 0.16
143 0.16
144 0.14
145 0.15
146 0.15
147 0.15
148 0.13
149 0.13
150 0.11
151 0.11
152 0.11
153 0.09
154 0.09
155 0.08
156 0.08
157 0.09
158 0.08
159 0.08
160 0.07
161 0.07
162 0.06
163 0.06
164 0.05
165 0.03
166 0.04
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.06
180 0.06
181 0.06
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.07
195 0.07
196 0.06
197 0.06
198 0.07
199 0.08
200 0.08
201 0.07
202 0.07
203 0.1
204 0.1
205 0.11
206 0.13
207 0.13
208 0.17
209 0.18
210 0.22
211 0.19
212 0.22
213 0.22
214 0.21
215 0.25
216 0.21
217 0.21
218 0.17
219 0.19
220 0.16
221 0.14
222 0.14
223 0.08
224 0.08
225 0.07
226 0.08
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.09
233 0.09
234 0.1
235 0.1
236 0.1
237 0.11
238 0.1
239 0.1
240 0.08
241 0.09
242 0.09
243 0.09
244 0.1
245 0.09
246 0.1
247 0.1
248 0.11
249 0.1
250 0.1
251 0.09
252 0.09
253 0.15
254 0.15
255 0.16
256 0.16
257 0.16
258 0.15
259 0.16
260 0.16
261 0.1
262 0.09
263 0.09
264 0.08
265 0.07
266 0.08
267 0.07
268 0.06
269 0.06
270 0.06
271 0.05
272 0.05
273 0.05
274 0.04
275 0.04
276 0.04
277 0.05
278 0.05
279 0.05
280 0.07
281 0.08
282 0.08
283 0.09
284 0.1
285 0.11
286 0.11
287 0.12
288 0.1
289 0.11
290 0.17
291 0.21
292 0.21
293 0.22
294 0.22
295 0.31
296 0.38
297 0.4
298 0.4
299 0.42
300 0.47
301 0.44
302 0.48
303 0.43
304 0.37
305 0.36
306 0.3
307 0.29
308 0.25
309 0.26
310 0.21
311 0.17
312 0.15
313 0.13
314 0.12
315 0.07
316 0.06
317 0.08
318 0.11
319 0.13
320 0.14
321 0.19
322 0.22
323 0.27
324 0.28
325 0.29
326 0.29
327 0.33
328 0.32
329 0.3
330 0.27
331 0.25
332 0.24
333 0.23
334 0.2
335 0.16
336 0.16
337 0.15
338 0.15
339 0.13
340 0.16
341 0.21
342 0.25
343 0.3
344 0.4
345 0.48
346 0.54
347 0.6
348 0.6
349 0.65
350 0.71
351 0.75
352 0.76
353 0.78
354 0.81