Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197KHH9

Protein Details
Accession A0A197KHH9   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-57IRNGHHQQQQLKNNNQRQQGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 9.5, cyto_nucl 8.833, cyto_mito 7.833, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008685  Centromere_Mis12  
Gene Ontology GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0051301  P:cell division  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF05859  Mis12  
Amino Acid Sequences MSHSIRNHTNTQGGTASRTGISNKNTTTSRQQNGSLEIRNGHHQQQQLKNNNQRQQGGVQSSATLTRPGSAGAGAVAASATAGTIAQQQESWIKSRQVYQQQLLTEHFGFSPLSFVDDVINSVNNMIYQASMALQEFVENEMEAWAIQNQSQLPKNYDAKVESAKGMHKFETLLEAAVDKNFDRFELYALKNLFGVPEDVDIVLPHYEALDFGIGADKEEELDKELELLRQQVIMTKAMNYKLRKELALEEGRRRELERCREQIGFLKDALKEYRDVAPIPQTLIFIRDNIETLHRRFGALHEKLQRNAQADQFASSAAASTGERAVSSVTALHEALLSQEQDQRVMYIRSVVRRQIDEHLGSETVVMHRSHNFTAPPTPSPPSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.22
5 0.23
6 0.24
7 0.26
8 0.3
9 0.33
10 0.33
11 0.37
12 0.38
13 0.41
14 0.48
15 0.5
16 0.52
17 0.49
18 0.53
19 0.51
20 0.55
21 0.56
22 0.51
23 0.44
24 0.42
25 0.4
26 0.42
27 0.42
28 0.41
29 0.39
30 0.4
31 0.47
32 0.52
33 0.6
34 0.63
35 0.69
36 0.74
37 0.78
38 0.8
39 0.77
40 0.7
41 0.63
42 0.58
43 0.56
44 0.5
45 0.42
46 0.36
47 0.3
48 0.28
49 0.27
50 0.23
51 0.17
52 0.14
53 0.13
54 0.13
55 0.12
56 0.12
57 0.1
58 0.09
59 0.07
60 0.07
61 0.06
62 0.05
63 0.05
64 0.04
65 0.03
66 0.03
67 0.03
68 0.02
69 0.02
70 0.03
71 0.07
72 0.08
73 0.09
74 0.09
75 0.11
76 0.15
77 0.17
78 0.2
79 0.2
80 0.23
81 0.24
82 0.3
83 0.37
84 0.43
85 0.48
86 0.47
87 0.47
88 0.46
89 0.47
90 0.43
91 0.38
92 0.29
93 0.23
94 0.2
95 0.17
96 0.15
97 0.12
98 0.12
99 0.08
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.1
106 0.09
107 0.09
108 0.07
109 0.08
110 0.07
111 0.06
112 0.07
113 0.06
114 0.05
115 0.04
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.08
136 0.09
137 0.12
138 0.17
139 0.18
140 0.2
141 0.26
142 0.29
143 0.28
144 0.3
145 0.27
146 0.26
147 0.27
148 0.25
149 0.2
150 0.19
151 0.21
152 0.22
153 0.22
154 0.2
155 0.18
156 0.17
157 0.16
158 0.17
159 0.14
160 0.11
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.09
173 0.15
174 0.15
175 0.19
176 0.19
177 0.2
178 0.18
179 0.18
180 0.16
181 0.1
182 0.1
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.03
199 0.03
200 0.06
201 0.06
202 0.06
203 0.07
204 0.06
205 0.06
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.08
212 0.09
213 0.09
214 0.09
215 0.1
216 0.09
217 0.09
218 0.09
219 0.11
220 0.12
221 0.13
222 0.13
223 0.14
224 0.17
225 0.2
226 0.27
227 0.25
228 0.28
229 0.33
230 0.34
231 0.32
232 0.31
233 0.3
234 0.32
235 0.39
236 0.38
237 0.38
238 0.4
239 0.41
240 0.4
241 0.38
242 0.36
243 0.36
244 0.43
245 0.45
246 0.45
247 0.48
248 0.48
249 0.48
250 0.49
251 0.45
252 0.37
253 0.29
254 0.29
255 0.25
256 0.28
257 0.28
258 0.21
259 0.18
260 0.18
261 0.22
262 0.2
263 0.2
264 0.19
265 0.23
266 0.23
267 0.24
268 0.22
269 0.18
270 0.17
271 0.19
272 0.18
273 0.13
274 0.14
275 0.13
276 0.13
277 0.13
278 0.19
279 0.2
280 0.22
281 0.28
282 0.26
283 0.26
284 0.26
285 0.3
286 0.34
287 0.33
288 0.39
289 0.42
290 0.45
291 0.47
292 0.51
293 0.5
294 0.44
295 0.43
296 0.39
297 0.35
298 0.31
299 0.32
300 0.27
301 0.22
302 0.19
303 0.16
304 0.13
305 0.08
306 0.08
307 0.06
308 0.08
309 0.09
310 0.09
311 0.09
312 0.08
313 0.09
314 0.08
315 0.09
316 0.09
317 0.09
318 0.11
319 0.11
320 0.11
321 0.1
322 0.1
323 0.11
324 0.12
325 0.12
326 0.12
327 0.16
328 0.16
329 0.17
330 0.18
331 0.17
332 0.19
333 0.19
334 0.18
335 0.22
336 0.25
337 0.32
338 0.36
339 0.41
340 0.42
341 0.43
342 0.46
343 0.46
344 0.49
345 0.44
346 0.4
347 0.38
348 0.33
349 0.3
350 0.27
351 0.22
352 0.16
353 0.17
354 0.16
355 0.16
356 0.2
357 0.25
358 0.26
359 0.29
360 0.29
361 0.29
362 0.36
363 0.39
364 0.38
365 0.39
366 0.41