Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JJI5

Protein Details
Accession A0A197JJI5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-80VYSSWPKKAWRNNWHKCCEDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, golg 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MTKPFALLTLLVLLALSVVQADVYCHCHNWLDQVMKKETRQCLGLGTVPQFKKINSKGVVVYSSWPKKAWRNNWHKCCEDASITSTGLTCFEGPDSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.02
5 0.02
6 0.02
7 0.03
8 0.04
9 0.05
10 0.11
11 0.12
12 0.13
13 0.14
14 0.15
15 0.15
16 0.19
17 0.23
18 0.23
19 0.26
20 0.31
21 0.35
22 0.37
23 0.39
24 0.4
25 0.37
26 0.33
27 0.31
28 0.26
29 0.23
30 0.21
31 0.21
32 0.17
33 0.17
34 0.21
35 0.2
36 0.22
37 0.21
38 0.2
39 0.26
40 0.27
41 0.32
42 0.28
43 0.3
44 0.28
45 0.3
46 0.3
47 0.23
48 0.24
49 0.24
50 0.26
51 0.25
52 0.25
53 0.27
54 0.33
55 0.42
56 0.5
57 0.52
58 0.6
59 0.7
60 0.79
61 0.82
62 0.76
63 0.7
64 0.62
65 0.56
66 0.48
67 0.4
68 0.34
69 0.3
70 0.27
71 0.25
72 0.23
73 0.18
74 0.16
75 0.15
76 0.11
77 0.09