Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D9C7

Protein Details
Accession J9D9C7    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
14-44KRKTDDYKEDPLKKRKKPSKIREHSKENSIKBasic
51-70AKIQCAKCKKKLRVSNNFVCHydrophilic
NLS Segment(s)
PositionSequence
24-41PLKKRKKPSKIREHSKEN
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MKNQVEESVAPALKRKTDDYKEDPLKKRKKPSKIREHSKENSIKEEGAKEAKIQCAKCKKKLRVSNNFVCRCGFIFCALHRFDDQHDCSYDFVKDGKEMLQKNNPKVYRGKMDRSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.35
4 0.41
5 0.49
6 0.5
7 0.59
8 0.65
9 0.72
10 0.75
11 0.76
12 0.79
13 0.79
14 0.84
15 0.82
16 0.83
17 0.85
18 0.87
19 0.88
20 0.89
21 0.92
22 0.9
23 0.9
24 0.83
25 0.82
26 0.78
27 0.68
28 0.62
29 0.53
30 0.45
31 0.37
32 0.34
33 0.27
34 0.22
35 0.2
36 0.17
37 0.17
38 0.2
39 0.23
40 0.23
41 0.28
42 0.36
43 0.41
44 0.48
45 0.56
46 0.59
47 0.65
48 0.74
49 0.76
50 0.77
51 0.8
52 0.8
53 0.8
54 0.75
55 0.66
56 0.57
57 0.48
58 0.38
59 0.32
60 0.23
61 0.16
62 0.15
63 0.15
64 0.2
65 0.2
66 0.21
67 0.19
68 0.2
69 0.2
70 0.26
71 0.28
72 0.26
73 0.27
74 0.26
75 0.27
76 0.27
77 0.25
78 0.18
79 0.17
80 0.14
81 0.13
82 0.14
83 0.18
84 0.23
85 0.26
86 0.31
87 0.4
88 0.46
89 0.52
90 0.6
91 0.57
92 0.54
93 0.58
94 0.58
95 0.6
96 0.6