Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A197JXZ1

Protein Details
Accession A0A197JXZ1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-108HGLMEIKKASRKQRKERKNRSKKLRGTKKAKAAVAKKBasic
NLS Segment(s)
PositionSequence
75-108MEIKKASRKQRKERKNRSKKLRGTKKAKAAVAKK
Subcellular Location(s) mito 14, cyto 8, cyto_nucl 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVVDIIHPARANISKDELREKLAKMYKVDKEVVFVFGFRTAFGGGKSTGFALIYDNLESAKKFEPKYRLVRHGLMEIKKASRKQRKERKNRSKKLRGTKKAKAAVAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.39
4 0.36
5 0.36
6 0.37
7 0.35
8 0.37
9 0.4
10 0.41
11 0.39
12 0.45
13 0.45
14 0.45
15 0.48
16 0.39
17 0.36
18 0.33
19 0.32
20 0.24
21 0.19
22 0.16
23 0.15
24 0.14
25 0.11
26 0.11
27 0.09
28 0.09
29 0.09
30 0.1
31 0.08
32 0.09
33 0.09
34 0.08
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.11
48 0.15
49 0.16
50 0.22
51 0.27
52 0.34
53 0.44
54 0.48
55 0.52
56 0.52
57 0.54
58 0.51
59 0.51
60 0.51
61 0.43
62 0.4
63 0.35
64 0.36
65 0.37
66 0.41
67 0.45
68 0.5
69 0.58
70 0.65
71 0.74
72 0.8
73 0.87
74 0.93
75 0.94
76 0.95
77 0.95
78 0.95
79 0.95
80 0.94
81 0.94
82 0.94
83 0.93
84 0.91
85 0.9
86 0.9
87 0.87
88 0.83