Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A197JNL3

Protein Details
Accession A0A197JNL3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-51RKRTAMRNELRKEKRRERRREGKEKKVKEGTBasic
NLS Segment(s)
PositionSequence
21-50RKRTAMRNELRKEKRRERRREGKEKKVKEG
Subcellular Location(s) mito 10, nucl 5, cyto 3, plas 3, extr 2, E.R. 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MCVCVLVLMSRSVVVVLVESRKRTAMRNELRKEKRRERRREGKEKKVKEGTTKKCLTRWSRPLTRTTAKVSHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.13
5 0.16
6 0.17
7 0.18
8 0.2
9 0.22
10 0.25
11 0.31
12 0.35
13 0.43
14 0.52
15 0.57
16 0.65
17 0.73
18 0.78
19 0.79
20 0.79
21 0.8
22 0.81
23 0.84
24 0.84
25 0.86
26 0.87
27 0.9
28 0.88
29 0.89
30 0.89
31 0.83
32 0.82
33 0.8
34 0.72
35 0.71
36 0.72
37 0.69
38 0.69
39 0.7
40 0.64
41 0.59
42 0.65
43 0.63
44 0.63
45 0.65
46 0.65
47 0.68
48 0.69
49 0.7
50 0.7
51 0.69
52 0.64
53 0.61